CNPY4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CNPY4 Polyclonal antibody, PBS Only (22086-1-PBS)

• 

  WB analysis using 22086-1-AP (same clone as 22086-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 22086-1-AP (CNPY4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22086-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 22086-1-AP (same clone as 22086-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 22086-1-AP (CNPY4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22086-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 22086-1-AP (same clone as 22086-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 22086-1-AP (CNPY4 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 22086-1-PBS in a different storage buffer formulation.

CNPY4 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 22086-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

canopy 4 homolog (zebrafish), PRAT4B, Protein canopy homolog 4, PSEC0237, UNQ1909/PRO4354

---

Product Information

22086-1-PBS targets CNPY4 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17285

  Product name: Recombinant human CNPY4 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 41-248 aa of BC032339

  Sequence: CKLLSTELQAELSRTGRSREVLELGQVLDTGKRKRHVPYSVSETRLEEALENLCERILDYSVHAERKGSLRYAKGQSQTMATLKGLVQKGVKVDLGIPLELWDEPSVEVTYLKKQCETMLEEFEDIVGDWYFHHQEQPLQNFLCEGHVLPAAETACLQETWTGKEITDGEEKTEGEEEQEEEEEEEEEEGGDKMTKTGSHPKLDREDL

• Full Name: canopy 4 homolog (zebrafish)
• Calculated Molecular Weight: 248 aa, 28 kDa
• Observed Molecular Weight: 28-30 kDa
• GenBank Accession Number: BC032339
• Gene Symbol: CNPY4
• Gene ID (NCBI): 245812
• RRID: AB_2878990
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N129
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CNPY4 (Canopy FGF Signaling Regulator 4) is a protein-coding gene located on chromosome 7q22.1 in humans. It belongs to the canopy family of proteins and encodes a Saposin-like (SAPLIP) protein, a structural class typically involved in lipid interactions