CNTD1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CNTD1 Polyclonal antibody, PBS Only (24854-1-PBS)

• 

  WB analysis of mouse colon using 24854-1-AP (same clone as 24854-1-PBS)

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 24854-1-AP (CNTD1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24854-1-PBS in a different storage buffer formulation.

CNTD1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 24854-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

24854-1-PBS targets CNTD1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21338

  Product name: Recombinant human CNTD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 203-330 aa of BC026187

  Sequence: MRLHATCLTLLDLVYLLHEPIYESLLRASIENSTPSQLQGEKFTSVKEDFMLLAVGIIAASAFIQNHECWSQVVGHLQSITGIALASIAEFSYAILTHGVGANTPGRQQSIPPHLAARALKTVASSNT

• Full Name: cyclin N-terminal domain containing 1
• Calculated Molecular Weight: 330 aa, 37 kDa
• Observed Molecular Weight: 35-37 kDa
• GenBank Accession Number: BC026187
• Gene Symbol: CNTD1
• Gene ID (NCBI): 124817
• RRID: AB_2879757
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N815
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.