CNTNAP4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CNTNAP4 Polyclonal antibody, PBS Only (32250-1-PBS)

• 

  WB analysis using 32250-1-AP (same clone as 32250-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32250-1-AP (CNTNAP4 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32250-1-PBS in a different storage buffer formulation.

CNTNAP4 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32250-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

CASPR4, Cell recognition molecule Caspr4, Contactin-associated protein-like 4, KIAA1763

---

Product Information

32250-1-PBS targets CNTNAP4 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37716

  Product name: Recombinant human CNTNAP4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1135-1241 aa of NM_033401.4

  Sequence: FSAVKSLVLGRILEHSDVDQDTALAGAQGFTGCLSAVQLSHVAPLKAALHPSHPDPVTVTGHVTESSCMAQPGTDATSRERTHSFADHSGTIDDREPLANAIKSDSA

• Full Name: contactin associated protein-like 4
• Calculated Molecular Weight: 145kDa，1308aa / 137 kDa，1235aa
• Observed Molecular Weight: 150 kDa, 137 kDa
• GenBank Accession Number: NM_033401.4
• Gene Symbol: CNTNAP4
• Gene ID (NCBI): 85445
• RRID: AB_3742553
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9C0A0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Contactin-associated protein-like 4 (Cntnap4) is critical for GABAergic transmission in the brain. Impaired Cntnap4 function is implicated in neurological disorders, such as autism. Loss of Cntnap4 causes pro-inflammatory cognitive decline (PMID: 37933376).