COA1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• COA1 Polyclonal antibody (25197-1-AP)

• 

  IF Staining of HeLa using 25197-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using COA1 antibody (25197-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red).

COA1 Polyclonal Antibody for IF/ICC, ELISA

Cat No. 25197-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, ELISA

Synonyms

C7orf44, MITRAC15, Mitochondrial translation regulation assembly intermediate of cytochrome c oxidase protein of 15 kDa, Cytochrome c oxidase assembly factor 1 homolog

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25197-1-AP targets COA1 in IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18313

  Product name: Recombinant human C7orf44 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-146 aa of BC056884

  Sequence: MMWQKYAGSRRSMPLGARILFHGVFYAGGFAIVYYLIQKFHSRALYYKLAVEQLQSHPEAQEALGPPLNIHYLKLIDRENFVDIVDAKLKIPVSGSKSEGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVKKE

• Full Name: Cytochrome c oxidase assembly factor 1 homolog
• Calculated Molecular Weight: 146 aa, 17 kDa
• GenBank Accession Number: BC056884
• Gene Symbol: COA1
• Gene ID (NCBI): 55744
• RRID: AB_3742140
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9GZY4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COA1, also named as C7orf44 and MITRAC15, is a mitochondrial translation regulation assembly intermediate of cytochrome c oxidase protein with MW 15 kDa. It's a component of some MITRAC complex, a cytochrome c oxidase (COX) assembly intermediate complex that regulates COX assembly. COA1 is required for assembly of mitochondrial respiratory chain complex I and complex IV.