COA5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• COA5 Polyclonal antibody, PBS Only (34046-1-PBS)

• 

  WB analysis using 34046-1-AP (same clone as 34046-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 34046-1-AP (COA5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 34046-1-PBS in a different storage buffer formulation.

COA5 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 34046-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

C2orf64

---

Product Information

34046-1-PBS targets COA5 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag41138

  Product name: Recombinant human COA5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-74 aa of BC047722

  Sequence: MPKYYEDKPQGGACAGLKEDLGACLLQSDCVVQEGKSPRQCLKEGYCNSLKYAFFECKRSVLDNRARFRGRKGY

• Full Name: Cytochrome c oxidase assembly factor 5
• Observed Molecular Weight: 8~12 kDa
• GenBank Accession Number: BC047722
• Gene Symbol: C2orf64
• Gene ID (NCBI): 493753
• RRID: AB_3743142
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q86WW8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The cytochrome c oxidase assembly factor 5 (COA5) gene, previously denoted as C2orf64, was first reported in humans when a homozygous missense variant (c.157G>C, p.Ala53Pro) in this gene was shown to cause mitochondrial disease. COA5 is a small mitochondrial protein required for an early step in the assembly of cytochrome-c oxidase (complex IV) of the respiratory chain. It contains a conserved twin-CX9C motif, is located in the mitochondrial inner membrane (PMID: 39779219).