COG5 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• COG5 Polyclonal antibody (31380-1-AP)

• 

  WB analysis using 31380-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31380-1-AP (COG5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

COG5 Polyclonal Antibody for WB, ELISA

Cat No. 31380-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Golgi transport complex 1, GOLTC1, GTC90

---

Tested Applications

• Positive WB detected in: HeLa cells, LNCaP cells, mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31380-1-AP targets COG5 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35394

  Product name: Recombinant human COG5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of NM_181733.2

  Sequence: MGWVGGRRRDSASPPGRSRSAADDINPAPANMEGGGGSVAVAGLGARGSGAAAATVRELLQDGCYSDFLNEDFDVKTYTSQSIHQAVIAEQLAKLAQGISQLDRELHLQVVARHEDLLAQATGIESLEGVLQMMQTRIGALQGAVDRIKAKIVEPYNKIVARTAQLARLQVACDLLRRIIRILNLSKRLQGQLQGGSREI

• Full Name: component of oligomeric golgi complex 5
• Calculated Molecular Weight: 93kDa，839aa
• Observed Molecular Weight: 87-93 kDa
• GenBank Accession Number: NM_181733.2
• Gene Symbol: COG5
• Gene ID (NCBI): 10466
• RRID: AB_3742422
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9UP83
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COG5 (Component Of Oligomeric Golgi Complex 5) is part of an eight-subunit Golgi-resident protein referred to as the conserved oligomeric golgi (COG) complex, which facilitates retrograde Golgi trafficking of vesicles that may include necessary glycosylation enzymes (PMID: 33277529). COG5 knockdown led to marked increases indicative of aberrant glycosylation (PMID: 25331899). The 92- and 87-kDa polypeptides could also be alternatively spliced isoforms of GTC-90 (PMID: 9792665)