COG7 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• COG7 Polyclonal antibody (13552-1-AP)

• 

  WB analysis using 13552-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13552-1-AP (COG7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Y79 using 13552-1-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 13552-1-AP (COG7 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human cervical cancer using 13552-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 13552-1-AP (COG7 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human cervical cancer using 13552-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 13552-1-AP (COG7 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

COG7 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13552-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

COG complex subunit 7, UNQ3082/PRO10013

---

Tested Applications

• Positive WB detected in: HEK-293 cells, Y79 cells, HeLa cells
• Positive IHC detected in: human cervical cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13552-1-AP targets COG7 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4335

  Product name: Recombinant human COG7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 419-770 aa of BC037563

  Sequence: CGLLSALKSLFAKYVSDFTSTLQSIRKKCKLDHIPPNSLFQEDWTAFQNSIRIIATCGELLRHCGDFEQQLANRILSTAGKYLSDSCSPRSLAGFQESILTDKKNSAKNPWQEYNYLQKDNPAEYASLMEILYTLKEKGSSNHNLLAAPRAALTRLNQQAHQLAFDSVFLRIKQQLLLISKMDSWNTAGIGETLTDELPAFSLTPLEYISNIGQYIMSLPLNLEPFVTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDAILQIPELSPHSAKQLATDIDYLINVMDALGLQPSRTLQHIVTLLKTRPEDYRQVSKGLPRRLATTVATMRSVNY

• Full Name: component of oligomeric golgi complex 7
• Calculated Molecular Weight: 770 aa, 86 kDa
• Observed Molecular Weight: 86 kDa
• GenBank Accession Number: BC037563
• Gene Symbol: COG7
• Gene ID (NCBI): 91949
• RRID: AB_2229608
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P83436
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COG7 (Component of Oligomeric Golgi Complex 7) is a critical protein-coding gene located on chromosome 16p12.2. By maintaining the structure and environment of the Golgi, COG7 is essential for the proper attachment of sugar chains (glycosylation) to proteins and lipids.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Boyan (Verified Customer) (09-28-2020)

This antibody recognised a clean band at the expected molecular weight.

• Applications: Western Blot