Collagen Type X Polyclonal antibody

• 

  WB analysis using 26984-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26984-1-AP (COL10A1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of ROS1728 using 26984-1-AP

  ROS1728 cells were subjected to SDS PAGE followed by western blot with 26984-1-AP (COL10A1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

Collagen Type X Polyclonal Antibody for WB, ELISA

Cat No. 26984-1-AP

Publications(8)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

COL10, COL10A1, Col10a 1, Collagen alpha-1(X) chain, Collagen type X alpha 1

---

Tested Applications

• Positive WB detected in: BxPC-3 cells, ROS1728 cells, HCT 116 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IHC: See 3 publications below
• IF: See 1 publications below

Product Information

26984-1-AP targets Collagen Type X in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25741

  Product name: Recombinant human COL10A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 518-585 aa of BC130621

  Sequence: QAVMPEGFIKAGQRPSLSGTPLVSANQGVTGMPVSAFTVILSKAYPAIGTPIPFDKILYNRQQHYDPR

• Full Name: collagen, type X, alpha 1
• Calculated Molecular Weight: 680 aa, 66 kDa
• Observed Molecular Weight: 60-66 kDa
• GenBank Accession Number: BC130621
• Gene Symbol: COL10A1
• Gene ID (NCBI): 1300
• RRID: AB_3085918
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q03692
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Collagen type X alpha 1 (COL10A1), a secreted, short-chain collagen, belongs to the collagen family, which is a major interstitial matrix component specifically expressed by hypertrophic chondrocytes. COL10A1 expression is elevated in many solid tumor types, such as colon cancer, esophagus cancer, and breast cancer, and displays vital roles in many critical cellular processes (PMID: 30154451, 25321476).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Hum Mol Genet; The p.W651fsX666 mutation on COL10A1 results in impaired trimerization of normal collagen X to induce Schmid type Metaphyseal chondrodysplasia; Authors - Jingye Yang
rat	IHC	J Orthop Res; Optimal Timing for Initiating Postoperative Mobilization for Healing Enthesis in Onto-Surface Repair; Authors - Takuma Naka
human	WB	J Orthop Surg Res; Gentiopicroside ameliorates the lipopolysaccharide-induced inflammatory response and hypertrophy in chondrocytes; Authors - Longfei Li
human	IF	Oncogene; Cancer-associated fibroblasts promote EGFR-TKI resistance via the CTHRC1/glycolysis/H3K18la positive feedback loop; Authors - Chen Zhang
mouse	WB,IHC	Bioact Mater; Immune-modulated adhesive hydrogel for enhancing osteochondral graft adhesion and cartilage repair; Authors - Jiaqi Zhou
mouse	WB	Inflammation; Calcified Cartilage Zone Remodeling Induced by IL-1β Derived from Necrotic Subchondral Bone Initiates Cartilage Degeneration in Patients with Glucocorticoids-induced Osteonecrosis of the Femoral Head; Authors - Pengbo Wang