Collagen Type I Recombinant monoclonal antibody, PBS Only (Capture)

Collagen Type I Uni-rAb® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 83752-3-PBS
Clone No.240665D2

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, Sandwich ELISA, Indirect ELISA, Sample test

COL1, COL1A2, 240665D2, Alpha-2 type I collagen, col I

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83752-3-PBS targets Collagen Type I as part of a matched antibody pair:

MP00716-3: 83752-3-PBS capture and 83752-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag6281

Product name: Recombinant human COL1A2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1017-1366 aa of BC054498

Sequence: RGLPGLKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGIRGPQGHQGPAGPPGPPGPPGPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK

Predict reactive species
Full Name collagen, type I, alpha 2
Calculated Molecular Weight 1366 aa, 130 kDa
Observed Molecular Weight100-160 kDa
GenBank Accession NumberBC054498
Gene Symbol COL1A2
Gene ID (NCBI) 1278
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP08123
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Type I collagen, the major structural component of connective tissues such as skin, tendon and bone, is the most abundant and widely expressed collagen in humans (PMID: 7620364; 8645190; 9016532). Type I collagen is a heterotrimer comprising one alpha 2(I) and two alpha 1(I) chains which are encoded by the unlinked loci COL1A2 and COL1A1 respectively. Type I collagen has a molecular mass of about 250-300 kDa, while the alpha 2(I) chain has a molecular weight of about 100-140 kDa. Mutations in COL1A2 gene are associated with osteogenesis imperfecta, Ehlers-Danlos syndrome, idiopathic osteoporosis, and atypical Marfan syndrome. This antibody raised against 1017-1366 aa of human pro-alpha 2 chain of type l collagen can recognize collagen alpha 2(1) chain and C-terminal propeptide of pro-alpha 2(1) chain.

Loading...
||
New chat Able
正在加载,请稍候...