COL8A1 Polyclonal antibody

• 

  WB analysis using 17251-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17251-1-AP (Collagen Type VIII antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 17251-1-AP

  IP result of anti-Collagen Type VIII (IP:17251-1-AP, 4ug; Detection:17251-1-AP 1:500) with HepG2 cells lysate 1800ug.

• 

  IF Staining of HepG2 using 17251-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using COL8A1 antibody (17251-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  IF Staining of HepG2 using 17251-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using COL8A1 antibody (17251-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• Featured Product
• KD/KO Validated

COL8A1 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 17251-1-AP

Publications(11)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

COL8, C3orf7, Collagen alpha-1(VIII) chain, Collagen Type VIII

---

Tested Applications

• Positive WB detected in: A375 cells, HeLa cells, HepG2 cells, COLO 320 cells, mouse kidney tissue, mouse spleen tissue, rat kidney tissue
• Positive IP detected in: HepG2 cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 8 publications below
• IHC: See 2 publications below
• IF: See 3 publications below

Product Information

17251-1-AP targets COL8A1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, canine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10607

  Product name: Recombinant human COL8A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 396-744 aa of BC013581

  Sequence: GIPGPMGPPGAIGFPGPKGEGGIVGPQGPPGPKGEPGLQGFPGKPGFLGEVGPPGMRGLPGPIGPKGEAGQKGVPGLPGVPGLLGPKGEPGIPGDQGLQGPPGIPGIGGPSGPIGPPGIPGPKGEPGLPGPPGFPGIGKPGVAGLHGPPGKPGALGPQGQPGLPGPPGPPGPPGPPAVMPPTPPPQGEYLPDMGLGIDGVKPPHAYGAKKGKNGGPAYEMPAFTAELTAPFPPVGAPVKFNKLLYNGRQNYNPQTGIFTCEVPGVYYFAYHVHCKGGNVWVALFKNNEPVMYTYDEYKKGFLDQASGSAVLLLRPGDRVFLQMPSEQAAGLYAGQYVHSSFSGYLLYPM

• Full Name: collagen, type VIII, alpha 1
• Calculated Molecular Weight: 744 aa, 73 kDa
• Observed Molecular Weight: 73 kDa
• GenBank Accession Number: BC013581
• Gene Symbol: COL8A1
• Gene ID (NCBI): 1295
• RRID: AB_10696173
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P27658
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Sci China Life Sci; Identification of LRRC46 as a novel candidate gene for high myopia; Authors - Lingxi Jiang
human	WB	Front Bioeng Biotechnol; Let-7i-5p Regulation of Cell Morphology and Migration Through Distinct Signaling Pathways in Normal and Pathogenic Urethral Fibroblasts.; Authors - Kaile Zhang
rat	IF	Front Cell Dev Biol; Platelet-Derived Extracellular Vesicles Increase Col8a1 Secretion and Vascular Stiffness in Intimal Injury.; Authors - Han Bao ; KD Validated
mouse	WB	FASEB J; Silencing of METTL3 attenuates cardiac fibrosis induced by myocardial infarction via inhibiting the activation of cardiac fibroblasts.; Authors - Tingting Li
rat	WB	Biomed Pharmacother; Compound Danshen Dripping Pill inhibits doxorubicin or isoproterenol-induced cardiotoxicity.; Authors - Ke Feng
mouse	WB,IF	Dis Model Mech; Upregulation of distinct collagen transcripts in post-surgery scar tissue: a study of conjunctival fibrosis.; Authors - Li-Fong Seet

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Kenzo (Verified Customer) (11-11-2023)

This antibody worked well for mouse eye cryosections.

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:100
• Cell Tissue Type: Eye