COMMD3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• COMMD3 Polyclonal antibody (26240-1-AP)

COMMD3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26240-1-AP Copied!

Publications (5)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

BUP, C10orf8, COMM domain containing 3, COMMD3, Protein Bup, Protein PIL

• 

  WB analysis of A549 using 26240-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 26240-1-AP (COMMD3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse thymus using 26240-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 26240-1-AP (COMMD3 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human thymus using 26240-1-AP

  Immunohistochemical analysis of paraffin-embedded human thymus tissue slide using 26240-1-AP (COMMD3 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human thymus using 26240-1-AP

  Immunohistochemical analysis of paraffin-embedded human thymus tissue slide using 26240-1-AP (COMMD3 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for COMMD3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, mouse thymus tissue
• Positive IHC detected in: human thymus tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26240-1-AP targets COMMD3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23968

  Product name: Recombinant human COMMD3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 18-195 aa of BC022898

  Sequence: RSFDSNAFTLLLRAAFQSLLDAQADEAVLDHPDLKHIDPVVLKHCHAAAATYILEAGKHRADKSTLSTYLEDCKFDRERIELFCTEYQNNKNSLEILLGSIGRSLPHITDVSWRLEYQIKTNQLHRMYRPAYLVTLSVQNTDSPSYPEISFSCSMEQLQDLVGKLKDASKSLERATQL

• Full Name: COMM domain containing 3
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC022898
• Gene Symbol: COMMD3
• Gene ID (NCBI): 23412
• RRID: AB_2880440
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UBI1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The COMMD3 Polyclonal antibody (Cat# 26240-1-AP) has 5 citations published in Nature Communications, Molecular Metabolism, mBio, Journal of Dermatological Science, and Biomedicines. The associated research fields include viral entry (SARS-CoV-2), insulin secretion and metabolism, endocytosis, skin pigmentation, and copper metabolism in multiple myeloma progression.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; A genome-wide CRISPR screen identifies host factors that regulate SARS-CoV-2 entry.; Authors - Yunkai Zhu
human	WB	Mol Metab; Genome-wide CRISPR screen identified a role for commander complex mediated ITGB1 recycling in basal insulin secretion.; Authors - Liu Yang
		mBio; VPS29 Exerts Opposing Effects on Endocytic Viral Entry; Authors - Daniel Poston
		J Dermatol Sci; COMMD3 mediates melanin synthesis through both clusterin-PAX3 axis and copper-dependent tyrosinase activity in skin pigmentation.; Authors - Xinyi Huang
human	WB	Biomedicines; COMMD3 Regulates Copper Metabolism via the ATOX1-ATP7A-LOX Axis to Promote Multiple Myeloma Progression; Authors - Yajun Wang