COMMD4 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84664-4-RR (same clone as 84664-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84664-4-RR (COMMD4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84664-4-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 84664-4-RR (same clone as 84664-4-PBS)

  WB result of COMMD4 antibody (84664-4-RR; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-COMMD4 transfected MCF-7 cells. This data was developed using the same antibody clone with 84664-4-PBS in a different storage buffer formulation.

• 

  IHC staining of rat testis using 84664-4-RR (same clone as 84664-4-PBS)

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 84664-4-RR (COMMD4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84664-4-PBS in a different storage buffer formulation.

• 

  IHC staining of rat testis using 84664-4-RR (same clone as 84664-4-PBS)

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 84664-4-RR (COMMD4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84664-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84664-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84664-4-RR against Human COMMD4 were performed. The affinity constant is below 1 pM.

• Featured Product
• KD/KO Validated

COMMD4 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 84664-4-PBS

Clone No.242175F4

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

242175F4, COMM domain containing 4, COMMD 4

---

Product Information

84664-4-PBS targets COMMD4 in WB, IHC, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34904

  Product name: Recombinant human COMMD4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-199 aa of BC068998

  Sequence: MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLMSSLG

• Full Name: COMM domain containing 4
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC068998
• Gene Symbol: COMMD4
• Gene ID (NCBI): 54939
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9H0A8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

COMMD4 is a protein-coding gene belonging to the COMMD family and is highly expressed in non-small cell lung cancer (NSCLC) and hepatocellular carcinoma (HCC) (PMID: 36249824). It has 3 isoforms and has been shown to control NF-κB activity and regulate the activity of cullin-RING E3 ubiquitin ligases (PMID: 32439936).