COMMD8 Polyclonal antibody

• 

  WB analysis of HEK-293 using 25237-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 25237-1-AP (COMMD8 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 25237-1-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 25237-1-AP (COMMD8 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HEK-293 using 25237-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using COMMD8 antibody (25237-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

COMMD8 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 25237-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

COMM domain-containing protein 8, COMMD 8, MDS022

---

Tested Applications

• Positive WB detected in: HEK-293 cells
• Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

25237-1-AP targets COMMD8 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18712

  Product name: Recombinant human COMMD8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 9-182 aa of BC008371

  Sequence: LWRLQKLPAELGPQLLHKIIDGICGRAYPVYQDYHTVWESEEWMHVLEDIAKFFKAIVGKNLPDEEIFQQLNQLNSLHQETIMKCVKSRKDEIKQALSREIVAISSAQLQDFDWQVKLALSSDKIAALRMPLLSLHLDVKENGEVKPYSIEMSREELQNLIQSLEAANKVVLQL

• Full Name: COMM domain containing 8
• Calculated Molecular Weight: 183 aa, 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC008371
• Gene Symbol: COMMD8
• Gene ID (NCBI): 54951
• RRID: AB_2879980
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NX08
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell; Structure of the endosomal Commander complex linked to Ritscher-Schinzel syndrome; Authors - Michael D Healy