COMMD9 Polyclonal antibody

• 

  WB analysis of HEK-293 using 31112-1-AP

  WB result of COMMD9 antibody (31112-1-AP; 1:1200; incubated at room temperature for 1.5 hours) with sh-Control and sh-COMMD9 transfected HEK-293 cells.

• 

  WB analysis using 31112-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31112-1-AP (COMMD9 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

COMMD9 Polyclonal Antibody for WB, ELISA

Cat No. 31112-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

C11orf55, COMM domain containing 9, COMM domain-containing protein 9, HSPC166, LINC00610

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31112-1-AP targets COMMD9 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35078

  Product name: Recombinant human COMMD9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-198 aa of BC010892

  Sequence: MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDTMLDGLGRIRDQLSAVASK

• Full Name: COMM domain containing 9
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC010892
• Gene Symbol: COMMD9
• Gene ID (NCBI): 29099
• RRID: AB_3669861
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9P000
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COMMD9, also known as HSPC166, is a member of the COMMD family of proteins. The COMMD protein family is an evolutionarily conserved gene family that plays a role in a number of critical biological processes, including inflammation, copper homeostasis, sodium balance, endosomal sorting and cancer. COMMD9 has been shown to participate in TFDP1/E2F1 activation and to play a critical role in non-small cell lung cancer (PMID: 27871936)