COMMD9 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84251-4-RR (same clone as 84251-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84251-4-RR (COMMD9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84251-4-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 84251-4-RR (same clone as 84251-4-PBS)

  WB result of COMMD9 antibody (84251-4-RR; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-COMMD9 transfected HEK-293 cells. This data was developed using the same antibody clone with 84251-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84251-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84251-4-RR against Human COMMD9 were performed. The affinity constant is 1.00 nM.

• Featured Product
• KD/KO Validated

COMMD9 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84251-4-PBS

Clone No.241505B4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

241505B4, C11orf55, COMM domain containing 9, COMM domain-containing protein 9, HSPC166

---

Product Information

84251-4-PBS targets COMMD9 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag35078

  Product name: Recombinant human COMMD9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-198 aa of BC010892

  Sequence: MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDTMLDGLGRIRDQLSAVASK

• Full Name: COMM domain containing 9
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC010892
• Gene Symbol: COMMD9
• Gene ID (NCBI): 29099
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9P000
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

COMMD9, also known as HSPC166, is a member of the COMMD family of proteins. The COMMD protein family is an evolutionarily conserved gene family that plays a role in a number of critical biological processes, including inflammation, copper homeostasis, sodium balance, endosomal sorting and cancer. COMMD9 has been shown to participate in TFDP1/E2F1 activation and to play a critical role in non-small cell lung cancer (PMID: 27871936)