Use Able AI chat for product recommendations

COP1 Polyclonal antibody

COP1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 28395-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, ELISA

RFWD2, E3 ubiquitin-protein ligase COP1, EC:2.3.2.27, hCOP1, RING finger protein 200

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHCT 116 cells
Positive IP detected inHCT 116 cells, HeLa cells
Positive IHC detected inmouse heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28395-1-AP targets COP1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag28163

Product name: Recombinant human COP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 274-493 aa of BC039723

Sequence: EMSGLYSPVSEDSTVPQFEAPSPSHSSIIDSTEYSQPPGFSGSSQTKKQPWYNSTLASRRKRLTAHFEDLEQCYFSTRMSRISDDSRTASQLDEFQECLSKFTRYNSVRPLATLSYASDLYNGSSIVSSIEFDRDCDYFAIAGVTKKIKVYEYDTVIQDAVDIHYPENEMTCNSKISCISWSSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHEKRCW

Predict reactive species
Full Name ring finger and WD repeat domain 2
Calculated Molecular Weight 731 aa, 80 kDa
Observed Molecular Weight 80-90 kDa
GenBank Accession NumberBC039723
Gene Symbol COP1
Gene ID (NCBI) 64326
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8NHY2
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COP1 (constitutive photomorphogenic 1) is also named Ring finger and WD domain 2 (RFWD2), RING finger protein 200 (RNF20). COP1 is an E3 ubiquitin ligase that modifies specific target proteins, priming their degradation via the ubiquitin proteasome system (PMID: 27335464). COP1 (also known as RFWD2) is an important suppressor of pathogenic c/EBPβ-dependent gene expression programs in microglia (PMID: 32795415). COP1 is as a tumour suppressor that negatively regulates ETV1, ETV4 and ETV5. The ubiquitin ligase COP1 is as a tumour suppressor whose downregulation promotes prostatic epithelial cell proliferation and tumorigenesis (PMID: 21572435). COP1 has been identified as a novel and critical negative regulator of the tumor suppressor protein p53, and it influences p53-dependent transcription, apoptosis, cell cycle arrest and DNA repair (PMID: 16931761, PMID: 15103385). Recently, COP1 has been found to be overexpressed in human hepatocellular carcinoma, breast cancer and ovarian adenocarcinomas (PMID: 15492238, PMID: 20959491).

Protocols

Product Specific Protocols
IHC protocol for COP1 antibody 28395-1-APDownload protocol
IP protocol for COP1 antibody 28395-1-APDownload protocol
WB protocol for COP1 antibody 28395-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...