COPE Polyclonal antibody

COPE Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11457-1-AP

Publications (1)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Coatomer subunit epsilon, Epsilon-coat protein, Epsilon-COP

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF/ICC

WB analysis using 11457-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 11457-1-AP (COPE antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of A375 using 11457-1-AP
A375 cells were subjected to SDS PAGE followed by western blot with 11457-1-AP (COPE antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human stomach cancer using 11457-1-AP
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 11457-1-AP (COPE antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human stomach cancer using 11457-1-AP
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 11457-1-AP (COPE antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat stomach using 11457-1-AP
Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 11457-1-AP (COPE antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat stomach using 11457-1-AP
Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 11457-1-AP (COPE antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse stomach using 11457-1-AP
Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 11457-1-AP (COPE antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse stomach using 11457-1-AP
Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 11457-1-AP (COPE antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 11457-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 11457-1-AP (COPE Antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 11457-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 11457-1-AP (COPE Antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HepG2 using 11457-1-AP
Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using COPE antibody (11457-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for COPE in ?

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	A431 cells, A375 cells, HEK-293 cells, Jurkat cells, MCF-7 cells, PC-3 cells
Positive IHC detected in	human stomach cancer tissue, human liver cancer tissue, mouse stomach tissue, rat stomach tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HepG2 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:8000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
Immunofluorescence (IF)/ICC	IF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11457-1-AP targets COPE in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag2024 Product name: Recombinant human COPE protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-308 aa of BC017285 Sequence: MAPPAPGPASGGSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSSPERDVERDVFLYRAYLAQRKFGVVLDEIKPSSAPELQAVRMFADYLAHESRRDSIVAELDREMSRSVDVTNTTFLLMAASIYLHDQNPDAALRALHQGDSLECTAMTVQILLKLDRLDLARKELKRMQDLDEDATLTQLATAWVSLATGGEKLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDKDSGYPETLVNLIVLSQHLGKPPEVTNRYLSQLKDAHRSHPFIKEYQAKENDFDRLVLQYAPSA Predict reactive species
Full Name	coatomer protein complex, subunit epsilon
Calculated Molecular Weight	34 kDa
Observed Molecular Weight	32-34 kDa
GenBank Accession Number	BC017285
Gene Symbol	COPE
Gene ID (NCBI)	11316
RRID	AB_11182386
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O14579
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COPE (Coatomer Protein Complex Subunit Epsilon) is the ε subunit of the COPI complex, a cytoplasmic protein complex composed of seven subunits. It mediates vesicle transport between the Golgi apparatus and the endoplasmic reticulum by binding a double lysine motif, and is crucial for retrograde protein transport (from the Golgi apparatus to the endoplasmic reticulum). (PMID: 10469566; 24497546; 20674546)

Protocols

Product Specific Protocols
IF protocol for COPE antibody 11457-1-AP	Download protocol
IHC protocol for COPE antibody 11457-1-AP	Download protocol
WB protocol for COPE antibody 11457-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The COPE Polyclonal antibody (Cat# 11457-1-AP) has 1 total citation. It appears in Science Advances (IF 13.9), in a study on the distinct roles of COPI proteins attenuated in cell senescence, using IP in human samples. The research field is cell senescence and vesicular transport, specifically involving the COPI coatomer protein complex and its role in retrograde Golgi-to-ER transport.