COPG2 Polyclonal antibody

• 

  WB analysis of mouse heart using 16111-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 16111-1-AP (COPG2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 16111-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 16111-1-AP (COPG2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 16111-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 16111-1-AP (COPG2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 16111-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 16111-1-AP (COPG2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human skeletal muscle using 16111-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 16111-1-AP (COPG2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 16111-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 16111-1-AP (COPG2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human heart using 16111-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 16111-1-AP (COPG2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse heart using 16111-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 16111-1-AP (COPG2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 16111-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 16111-1-AP (COPG2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 16111-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 16111-1-AP (COPG2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 16111-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 16111-1-AP (COPG2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human heart using 16111-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 16111-1-AP (COPG2 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human heart using 16111-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 16111-1-AP (COPG2 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human cerebellum using 16111-1-AP

  Immunohistochemical analysis of paraffin-embedded human cerebellum using 16111-1-AP (COPG2 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human cerebellum using 16111-1-AP

  Immunohistochemical analysis of paraffin-embedded human cerebellum using 16111-1-AP (COPG2 antibody) at dilution of 1:50 (under 40x lens).

COPG2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16111-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

2 COP, Coatomer subunit gamma 2, COPG2, Gamma 2 coat protein, Gamma 2 COP

---

Tested Applications

• Positive WB detected in: mouse heart tissue, HeLa cells, human heart tissue, human skeletal muscle tissue, mouse brain tissue, mouse kidney tissue
• Positive IHC detected in: mouse heart tissue, human cerebellum tissue, human heart tissue, mouse cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

16111-1-AP targets COPG2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9034

  Product name: Recombinant human COPG2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 517-865 aa of BC017443

  Sequence: EVRDRATFYLNVLQQRQMALNATYIFNGLTVSVPGMEKALHQYTLEPSEKPFDMKSIPLAMAPVFEQKAEITLVATKPEKLAPSRQDIFQEQLAAIPEFLNIGPLFKSSEPVQLTEAETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQMEPSDSYEVLSCIPAPSLPYNQPGICYTLVRLPDDDPTAVAGSFSCTMKFTVRDCDPNTGVPDEDGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDTFEKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKVPENKNSHSLYLAGIFRGGYDLLVRSRLALADGVTMQVTVRSKERTPVDVILASVG

• Full Name: coatomer protein complex, subunit gamma 2
• Calculated Molecular Weight: 871 aa, 98 kDa
• Observed Molecular Weight: 98 kDa
• GenBank Accession Number: BC017443
• Gene Symbol: COPG2
• Gene ID (NCBI): 26958
• RRID: AB_10897182
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UBF2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Biochem Biophys Res Commun; Identification and characterization of an endoplasmic reticulum localization motif.; Authors - Yong-Wei Nie