COPG2 Polyclonal antibody

COPG2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16111-1-AP

Publications (1)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

Coatomer subunit gamma-2, Gamma-2-coat protein, Gamma-2-COP

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis of mouse heart using 16111-1-AP
mouse heart tissue were subjected to SDS PAGE followed by western blot with 16111-1-AP (COPG2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse brain using 16111-1-AP
mouse brain tissue were subjected to SDS PAGE followed by western blot with 16111-1-AP (COPG2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse heart using 16111-1-AP
mouse heart tissue were subjected to SDS PAGE followed by western blot with 16111-1-AP (COPG2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HeLa using 16111-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 16111-1-AP (COPG2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of human heart using 16111-1-AP
human heart tissue were subjected to SDS PAGE followed by western blot with 16111-1-AP (COPG2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of human skeletal muscle using 16111-1-AP
human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 16111-1-AP (COPG2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse kidney using 16111-1-AP
mouse kidney tissue were subjected to SDS PAGE followed by western blot with 16111-1-AP (COPG2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse heart using 16111-1-AP
Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 16111-1-AP (COPG2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse heart using 16111-1-AP
Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 16111-1-AP (COPG2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse cerebellum using 16111-1-AP
Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 16111-1-AP (COPG2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse cerebellum using 16111-1-AP
Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 16111-1-AP (COPG2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human heart using 16111-1-AP
Immunohistochemical analysis of paraffin-embedded human heart using 16111-1-AP (COPG2 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human heart using 16111-1-AP
Immunohistochemical analysis of paraffin-embedded human heart using 16111-1-AP (COPG2 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human cerebellum using 16111-1-AP
Immunohistochemical analysis of paraffin-embedded human cerebellum using 16111-1-AP (COPG2 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human cerebellum using 16111-1-AP
Immunohistochemical analysis of paraffin-embedded human cerebellum using 16111-1-AP (COPG2 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for COPG2 in ?

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	mouse heart tissue, HeLa cells, human heart tissue, human skeletal muscle tissue, mouse brain tissue, mouse kidney tissue
Positive IHC detected in	mouse heart tissue, human cerebellum tissue, human heart tissue, mouse cerebellum tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16111-1-AP targets COPG2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag9034 Product name: Recombinant human COPG2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 517-865 aa of BC017443 Sequence: EVRDRATFYLNVLQQRQMALNATYIFNGLTVSVPGMEKALHQYTLEPSEKPFDMKSIPLAMAPVFEQKAEITLVATKPEKLAPSRQDIFQEQLAAIPEFLNIGPLFKSSEPVQLTEAETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQMEPSDSYEVLSCIPAPSLPYNQPGICYTLVRLPDDDPTAVAGSFSCTMKFTVRDCDPNTGVPDEDGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDTFEKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKVPENKNSHSLYLAGIFRGGYDLLVRSRLALADGVTMQVTVRSKERTPVDVILASVG Predict reactive species
Full Name	coatomer protein complex, subunit gamma 2
Calculated Molecular Weight	871 aa, 98 kDa
Observed Molecular Weight	98 kDa
GenBank Accession Number	BC017443
Gene Symbol	COPG2
Gene ID (NCBI)	26958
RRID	AB_10897182
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9UBF2
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for COPG2 antibody 16111-1-AP	Download protocol
WB protocol for COPG2 antibody 16111-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The COPG2 Polyclonal antibody (Cat# 16111-1-AP) has 1 total citation. It appears in Biochemical and Biophysical Research Communications (IF 2.5), published in 2016. The cited study, "Identification and characterization of an endoplasmic reticulum localization motif," falls within the field of cell biology, specifically focusing on protein subcellular localization and endoplasmic reticulum targeting mechanisms in human cells. The antibody was applied in Western blotting for this research.

Species	Application	Title
human	WB	Biochem Biophys Res Commun Identification and characterization of an endoplasmic reticulum localization motif. Authors - Yong-Wei Nie View Article