COPS3 Polyclonal antibody

• 

  WB analysis using 30494-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30494-1-AP (COPS3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 30494-1-AP

  WB result of COPS3 antibody (30494-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-COPS3 transfected HeLa cells.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 30494-1-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 30494-1-AP (COPS3 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 30494-1-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 30494-1-AP (COPS3 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

COPS3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 30494-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

JAB1-containing signalosome subunit 3, COP 9 signalosome complex subunit 3

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells, mouse brain tissue, rat brain tissue
• Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30494-1-AP targets COPS3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32825

  Product name: Recombinant human COPS3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 270-423 aa of BC001891

  Sequence: NNPSELRNLVNKHSETFTRDNNMGLVKQCLSSLYKKNIQRLTKTFLTLSLQDMASRVQLSGPQEAEKYVLHMIEDGEIFASINQKDGMVSFHDNPEKYNNPAMLHNIDQEMLKCIELDERLKAMDQEITVNPQFVQKSMGSQEDDSGNKPSSYS

• Full Name: COP9 constitutive photomorphogenic homolog subunit 3 (Arabidopsis)
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC001891
• Gene Symbol: COPS3
• Gene ID (NCBI): 8533
• RRID: AB_3086336
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UNS2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COPS3 possesses kinase activity that phosphorylates regulators involved in signal transduction. It phosphorylates I kappa-Balpha, p105, and c-Jun. It acts as a docking site for complex-mediated phosphorylation. The gene is located within the Smith-Magenis syndrome region on chromosome 17.