COPS7B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• COPS7B Polyclonal antibody (32695-1-AP)

• 

  WB analysis using 32695-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32695-1-AP (COPS7B antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 32695-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32695-1-AP (COPS7B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

COPS7B Polyclonal Antibody for WB, ELISA

Cat No. 32695-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

COP9 signalosome complex subunit 7b, CSN7B, JAB1-containing signalosome subunit 7b, SGN7b, Signalosome subunit 7b

---

Tested Applications

• Positive WB detected in: HeLa cells, human testis tissue, mouse testis tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32695-1-AP targets COPS7B in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38543

  Product name: Recombinant human COPS7B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 100-264 aa of NM_022730.3

  Sequence: TIVSLASRMKCIPYSVLLKDLEMRNLRELEDLIIEAVYTDIIQGKLDQRNQLLEVDFCIGRDIRKKDINNIVKTLHEWCDGCEAVLLGIEQQVLRANQYKENHNRTQQQVEAEVTNIKKTLKATASSSAQEMEQQLAERECPPHAEQRQPTKKMSKVKGLVSSRH*

• Full Name: COP9 constitutive photomorphogenic homolog subunit 7B (Arabidopsis)
• Calculated Molecular Weight: 30 kDa，264 aa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: NM_022730.3
• Gene Symbol: COPS7B
• Gene ID (NCBI): 64708
• RRID: AB_3742712
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9H9Q2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COP9 signalosome complex subunit 7b (COPS7B, also known as CSN7B) is a component of the ribo-interactome that interacts with ribosomes to facilitate ribosome biogenesis and mRNA translation initiation (PMID: 27903243). Increased expression of COPS7B mediated by IGF2BP3 elevates the translational efficiency of genes enriched in mRNA translation and ribosome biogenesis pathways, promoting protein synthesis and driving progression in colorectal cancer (PMID: 37560971).