Use Able AI chat for product recommendations
  • KD/KO Validated

COPS8/COP9 Polyclonal antibody

COPS8/COP9 Polyclonal Antibody for WB, IHC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

COP9, COPS8, CSN8, hCOP9, JAB1-containing signalosome subunit 8

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for COPS8/COP9 in ?

Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, SH-SY5Y cells, PC-12 cells, mouse brain tissue, rat brain tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inhuman colon cancer tissue, mouse brain tissue, human gliomas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10089-2-AP targets COPS8/COP9 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0143

Product name: Recombinant human COPS8 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 14-194 aa of BC003090

Sequence: KKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNE

Predict reactive species
Full Name COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis)
Calculated Molecular Weight 23 kDa
Observed Molecular Weight 23 kDa
GenBank Accession NumberBC003090
Gene Symbol COPS8
Gene ID (NCBI) 10920
RRIDAB_2081903
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ99627
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COPS8 is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases.

Protocols

Product Specific Protocols
IHC protocol for COPS8/COP9 antibody 10089-2-APDownload protocol
IP protocol for COPS8/COP9 antibody 10089-2-APDownload protocol
WB protocol for COPS8/COP9 antibody 10089-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The COPS8/COP9 Polyclonal antibody (Cat# 10089-2-AP) has 5 total citations. These appear in J Transl Med, Front Bioeng Biotechnol, Neuropsychiatr Dis Treat, Biochem Biophys Res Commun, and bioRxiv. Research fields span ovarian cancer senescence under hypoxia, urethral fibroblast migration, neuroinflammation in cerebral ischemia/reperfusion injury, COP9 signalosome–SCF E3 ligase regulation, and PHD2-mediated protein neddylation. All citations used WB as the application in human or mouse samples.

SpeciesApplicationTitle
human, mouseWB

J Transl Med

Upregulation of CSN8 induces a unique senescence-like state with robust tumor-promoting properties in epithelial ovarian cancer cells under hypoxia.

Authors - Mengyuan Ruan
humanWB

Front Bioeng Biotechnol

Let-7i-5p Regulation of Cell Morphology and Migration Through Distinct Signaling Pathways in Normal and Pathogenic Urethral Fibroblasts.

Authors - Kaile Zhang
mouseWB

Neuropsychiatr Dis Treat

COP9 Signalosome Subunit 3 Restricts Neuroinflammatory Responses During Cerebral Ischemia/Reperfusion Injury Through Stabilizing Suppressor of Cytokine Signaling 3 Protein.

Authors - En Liang
humanWB

Biochem Biophys Res Commun

Rig-G negatively regulates SCF-E3 ligase activities by disrupting the assembly of COP9 signalosome complex.

Authors - Xu Gui-Ping GP
humanWB

bioRxiv

Crosslinking-mediated Interactome Analysis Identified PHD2-HIF1α Interaction Hotspots and the Role of PHD2 in Regulating Protein Neddylation

Authors - Haiping Ouyang
Loading...
||
New chat

Able™

正在加载,请稍候...