COQ10A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• COQ10A Polyclonal antibody (17812-1-AP)

COQ10A Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 17812-1-AP Copied!

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Coenzyme Q-binding protein COQ10 homolog A, mitochondrial

• 

  WB analysis of human heart using 17812-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 17812-1-AP (COQ10A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 17812-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17812-1-AP (COQ10A antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse skeletal muscle using 17812-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 17812-1-AP (COQ10A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 17812-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using COQ10A antibody (17812-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for COQ10A in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse heart tissue, human heart tissue, mouse skeletal muscle tissue, rat heart tissue, rat skeletal muscle tissue
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17812-1-AP targets COQ10A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12126

  Product name: Recombinant human COQ10A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-247 aa of BC073923

  Sequence: MAWAGSRRVPAGTRAAAERCCRLSLSPGAQPAPPPGPLPPPRPMRFLTSCSLLLPRAAQILAAEAGLPSSRSFMGFAAPFTNKRKAYSERRIMGYSMQEMYEVVSNVQEYREFVPWCKKSLVVSSRKGHLKAQLEVGFPPVMERYTSAVSMVKPHMVKAVCTDGKLFNHLETIWRFSPGIPAYPRTCTVDFSISFEFRSLLHSQLATMFFDEVVKQNVAAFERRAATKFGPETAIPRELMFHEVHQT

• Full Name: coenzyme Q10 homolog A (S. cerevisiae)
• Calculated Molecular Weight: 247 aa, 28 kDa
• Observed Molecular Weight: 20-23 kDa
• GenBank Accession Number: BC073923
• Gene Symbol: COQ10A
• Gene ID (NCBI): 93058
• RRID: AB_2081926
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96MF6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The UBIAD1 (COQ10A) affinity purification antibody (Cat# 17812-1-AP) has 6 citations across five journals: Frontiers in Pharmacology, Molecular Medicine Reports, Journal of Lipid Research, Frontiers in Oncology, and BMC Pregnancy and Childbirth. Research fields span ferroptosis in cervical and breast cancer, cardiac hypertrophy, coenzyme Q10 lipid metabolism, and preeclampsia biomarker discovery. Applications include WB and IHC in human and rat samples.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Front Pharmacol; Propofol Augments Paclitaxel-Induced Cervical Cancer Cell Ferroptosis In Vitro.; Authors - Meng-Yun Zhao
rat	WB	Mol Med Rep; UBIAD1 expression is associated with cardiac hypertrophy in spontaneously hypertensive rats.; Authors - Bingju Yan
human	WB	Mol Med Rep; Depletion of ubiA prenyltransferase domain containing 1 expression promotes angiotensin II‑induced hypertrophic response in AC16 human myocardial cells via modulating the expression levels of coenzyme Q10 and endothelial nitric oxide synthase.; Authors - Bingju Yan
human	WB	J Lipid Res; Human COQ10A and COQ10B are distinct lipid-binding START domain proteins required for coenzyme Q function.; Authors - Hui S Tsui
Human	WB	Front Oncol; Propofol Inhibits Proliferation and Augments the Anti-Tumor Effect of Doxorubicin and Paclitaxel Partly Through Promoting Ferroptosis in Triple-Negative Breast Cancer Cells.; Authors - Chen Sun
human	IHC	BMC Pregnancy Childbirth; FSP1 and CoQ10 have the potential to serve as biomarkers for severe preeclampsia.; Authors - Peishan Li