COQ10A Polyclonal antibody

• 

  WB analysis of human heart using 17812-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 17812-1-AP (COQ10A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 17812-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17812-1-AP (COQ10A antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 17812-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 17812-1-AP (COQ10A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 17812-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 17812-1-AP (COQ10A antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

COQ10A Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 17812-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Coenzyme Q-binding protein COQ10 homolog A, mitochondrial

---

Tested Applications

• Positive WB detected in: mouse heart tissue, human heart tissue, mouse skeletal muscle tissue, rat heart tissue, rat skeletal muscle tissue
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IHC: See 1 publications below

Product Information

17812-1-AP targets COQ10A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12126

  Product name: Recombinant human COQ10A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-247 aa of BC073923

  Sequence: MAWAGSRRVPAGTRAAAERCCRLSLSPGAQPAPPPGPLPPPRPMRFLTSCSLLLPRAAQILAAEAGLPSSRSFMGFAAPFTNKRKAYSERRIMGYSMQEMYEVVSNVQEYREFVPWCKKSLVVSSRKGHLKAQLEVGFPPVMERYTSAVSMVKPHMVKAVCTDGKLFNHLETIWRFSPGIPAYPRTCTVDFSISFEFRSLLHSQLATMFFDEVVKQNVAAFERRAATKFGPETAIPRELMFHEVHQT

• Full Name: coenzyme Q10 homolog A (S. cerevisiae)
• Calculated Molecular Weight: 247 aa, 28 kDa
• Observed Molecular Weight: 20-23 kDa
• GenBank Accession Number: BC073923
• Gene Symbol: COQ10A
• Gene ID (NCBI): 93058
• RRID: AB_2081926
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96MF6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
Human	WB	Front Oncol; Propofol Inhibits Proliferation and Augments the Anti-Tumor Effect of Doxorubicin and Paclitaxel Partly Through Promoting Ferroptosis in Triple-Negative Breast Cancer Cells.; Authors - Chen Sun
human	WB,IHC	Front Pharmacol; Propofol Augments Paclitaxel-Induced Cervical Cancer Cell Ferroptosis In Vitro.; Authors - Meng-Yun Zhao
human	WB	Mol Med Rep; Depletion of ubiA prenyltransferase domain containing 1 expression promotes angiotensin II‑induced hypertrophic response in AC16 human myocardial cells via modulating the expression levels of coenzyme Q10 and endothelial nitric oxide synthase.; Authors - Bingju Yan
rat	WB	Mol Med Rep; UBIAD1 expression is associated with cardiac hypertrophy in spontaneously hypertensive rats.; Authors - Bingju Yan
human	WB	J Lipid Res; Human COQ10A and COQ10B are distinct lipid-binding START domain proteins required for coenzyme Q function.; Authors - Hui S Tsui