COQ10A Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86557-1-RR (same clone as 86557-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86557-1-RR (COQ10A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86557-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86557-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86557-1-RR against Human COQ10A were performed. The affinity constant is 0.753 nM.

COQ10A Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86557-1-PBS

Clone No.251388G7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Coenzyme Q-binding protein COQ10 homolog A, mitochondrial

---

Product Information

86557-1-PBS targets COQ10A in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag12126

  Product name: Recombinant human COQ10A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-247 aa of BC073923

  Sequence: MAWAGSRRVPAGTRAAAERCCRLSLSPGAQPAPPPGPLPPPRPMRFLTSCSLLLPRAAQILAAEAGLPSSRSFMGFAAPFTNKRKAYSERRIMGYSMQEMYEVVSNVQEYREFVPWCKKSLVVSSRKGHLKAQLEVGFPPVMERYTSAVSMVKPHMVKAVCTDGKLFNHLETIWRFSPGIPAYPRTCTVDFSISFEFRSLLHSQLATMFFDEVVKQNVAAFERRAATKFGPETAIPRELMFHEVHQT

• Full Name: coenzyme Q10 homolog A (S. cerevisiae)
• Calculated Molecular Weight: 247 aa, 28 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC073923
• Gene Symbol: COQ10A
• Gene ID (NCBI): 93058
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96MF6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.