Product Information
30909-1-PBS targets COQ2 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29155 Product name: Recombinant human COQ2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 35-146 aa of BC008804 Sequence: AGAPHGGDLQPPACPEPRGRQLSLSAAAVVDSAPRPLQPYLRLMRLDKPIGTWLLYLPCTWSIGLAAEPGCFPDWYMLSLFGTGAILMRGAGCTINDMWDQDYDKKVTRTAN Predict reactive species |
| Full Name | coenzyme Q2 homolog, prenyltransferase (yeast) |
| Calculated Molecular Weight | 371 aa, 40 kDa |
| Observed Molecular Weight | 35 kDa，40 kDa，45 kDa |
| GenBank Accession Number | BC008804 |
| Gene Symbol | COQ2 |
| Gene ID (NCBI) | 27235 |
| RRID | AB_3669780 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q96H96 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
COQ2 (coenzyme Q2, polyprenyltransferase), also known as CL640. It is expected to be located in mitochondrion inner membrane. And the protein is highly expressed in skeletal muscle, adrenal glands and the heart. COQ2 is a redox carrier in the mitochondrial respiratory chain and a lipid-soluble antioxidant. This enzyme, which is part of the coenzyme Q10 pathway, catalyzes the prenylation of parahydroxybenzoate with an all-trans polyprenyl group. Mutations in this gene cause coenzyme Q10 deficiency, a mitochondrial encephalomyopathy, and also COQ2 nephropathy, an inherited form of mitochondriopathy with primary renal involvement. The protein has three isforms, the calculated molecular weight are 35, 40, 45 kDa.
