COQ7 Polyclonal antibody

• 

  WB analysis of mouse liver using 15083-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 15083-1-AP (COQ7 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 15083-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 15083-1-AP (COQ7 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 15083-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 15083-1-AP (COQ7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse liver using 15083-1-AP

  IP result of anti-COQ7 (IP:15083-1-AP, 4ug; Detection:15083-1-AP 1:500) with mouse liver tissue lysate 6000ug.

• 

  IHC staining of human liver cancer using 15083-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 15083-1-AP (COQ7 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human liver cancer using 15083-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 15083-1-AP (COQ7 antibody) at dilution of 1:100 (under 40x lens).

• Featured Product
• KD/KO Validated

COQ7 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 15083-1-AP

Publications(23)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

CAT5, CLK1, EC:1.14.99.60, Timing protein clk-1 homolog, Ubiquinone biosynthesis monooxygenase COQ7

---

Tested Applications

• Positive WB detected in: mouse liver tissue, mouse heart tissue
• Positive IP detected in: mouse liver tissue
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 4 publications below
• WB: See 22 publications below
• IF: See 1 publications below

Product Information

15083-1-AP targets COQ7 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7161

  Product name: Recombinant human COQ7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-217 aa of BC003185

  Sequence: MSCAGAAAAPRLWRLRPGARRSLSAYGRRTSVRFRSSGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL

• Full Name: coenzyme Q7 homolog, ubiquinone (yeast)
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 20~24 kDa
• GenBank Accession Number: BC003185
• Gene Symbol: COQ7
• Gene ID (NCBI): 10229
• RRID: AB_2082207
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99807
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COQ7(Ubiquinone biosynthesis protein COQ7 homolog) catalyzes the production of coenzyme Q (CoQ) in mitochondria. The predicted protein contains 179 amino acids, is mostly helical, and contains an alpha-helical membrane insertion. It has a potential N-glycosylation site, a phosphorylation site for protein kinase C and another for casein kinase II, and 3 N-myristoylation sites. This protein has 2 isoforms produced by alternative splicing with MW 20-24 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Nat Cell Biol; A nuclear role for the respiratory enzyme CLK-1 in regulating mitochondrial stress responses and longevity.; Authors - Richard M Monaghan
human	WB	J Clin Invest; ADCK4 mutations promote steroid-resistant nephrotic syndrome through CoQ10 biosynthesis disruption.; Authors - Ashraf Shazia S ; KD Validated
mouse	WB	Nat Commun; Hepatic HuR modulates lipid homeostasis in response to high-fat diet.; Authors - Zhuojun Zhang
mouse	WB	EMBO Mol Med; β-RA reduces DMQ/CoQ ratio and rescues the encephalopathic phenotype in Coq9 R239X mice.; Authors - Agustín Hidalgo-Gutiérrez
mouse	WB	Redox Biol; The Q-junction and the inflammatory response are critical pathological and therapeutic factors in CoQ deficiency.; Authors - Pilar González-García
mouse	WB	Acta Pharmacol Sin; Dysregulation of iron homeostasis and methamphetamine reward behaviors in Clk1-deficient mice.; Authors - Peng-Ju Yan

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Ying (Verified Customer) (04-26-2021)

It's super clean and works great.

• Applications: Western Blot
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: mouse and human fibroblasts, mouse tissues and human muscle biopsy samples