CoraLite® Plus 488-conjugated CORO1A Polyclonal antibody

• 

  IF Staining of human colon using CL488-17760

  Immunofluorescent analysis of (4% PFA) fixed human colon tissue using CoraLite® Plus 488 CORO1A antibody (CL488-17760) at dilution of 1:200.

• 

  IF Staining of human colon using CL488-17760

  Immunofluorescent analysis of (4% PFA) fixed human colon tissue using CoraLite® Plus 488 CORO1A antibody (CL488-17760) at dilution of 1:200.

• 

  IF Staining of mouse spleen using CL488-17760

  Immunofluorescent analysis of (4% PFA) fixed mouse spleen tissue using CoraLite® Plus 488 CORO1A antibody (CL488-17760) at dilution of 1:200.

• 

  IF Staining of mouse spleen using CL488-17760

  Immunofluorescent analysis of (4% PFA) fixed mouse spleen tissue using CoraLite® Plus 488 CORO1A antibody (CL488-17760) at dilution of 1:200.

• 

  FC experiment of Jurkat using CL488-17760

  1X10^6 Jurkat cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human CORO1A (CL488-17760) (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

CORO1A Polyclonal Antibody for IF-P, FC (Intra)

Cat No. CL488-17760

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P, FC (Intra)

Synonyms

Coronin 1A, CORO1, Clipin-A, CLIPINA, Clipin A

---

Tested Applications

• Positive IF-P detected in: human colon tissue, mouse spleen tissue
• Positive FC (Intra) detected in: Jurkat cells

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-17760 targets CORO1A in IF-P, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12139

  Product name: Recombinant human CORO1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-461 aa of BC110374

  Sequence: MSRQVVRSSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFVALICEASGGGAFLVLPLGKTGRVDKNAPTVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPDGGLMLPLREPVVTLEGHTKRVGIVAWHTTAQNVLLSAGCDNVIMVWDVGTGAAMLTLGPEVHPDTIYSVDWSRDGGLICTSCRDKRVRIIEPRKGTVVAEKDRPHEGTRPVRAVFVSEGKILTTGFSRMSERQVALWDTKHLEEPLSLQELDTSSGVLLPFFDPDTNIVYLCGKGDSSIRYFEITSEAPFLHYLSMFSSKESQRGMGYMPKRGLEVNKCEIARFYKLHERRCEPIAMTVPRKSDLFQEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK

• Full Name: coronin, actin binding protein, 1A
• Calculated Molecular Weight: 461 aa, 51 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC110374
• Gene Symbol: CORO1A
• Gene ID (NCBI): 11151
• RRID: AB_3084008
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P31146
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.