CORO1B Polyclonal antibody

• 

  WB analysis using 31091-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31091-1-AP (CORO1B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse liver using 31091-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 31091-1-AP (CORO1B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary cancer using 31091-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 31091-1-AP (CORO1B antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CORO1B Polyclonal Antibody for WB, IHC, ELISA

Cat No. 31091-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Coronin-2, Coronin-1B, CORONIN 2, Coronin 1B

---

Tested Applications

• Positive WB detected in: HT-29 cells, MDA-MB-453 cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue
• Positive IHC detected in: mouse liver tissue, human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31091-1-AP targets CORO1B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34813

  Product name: Recombinant human CORO1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 393-489 aa of BC006449

  Sequence: REAYVPSKQRDLKISRRNVLSDSRPAMAPGSSHLGAPASTTTAADATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGDA

• Full Name: coronin, actin binding protein, 1B
• Calculated Molecular Weight: 498 aa, 54 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC006449
• Gene Symbol: CORO1B
• Gene ID (NCBI): 57175
• RRID: AB_3669849
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BR76
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CORO1B (Coronin 1B) is an actin-binding protein that controls actin networks at classical lamellipodia (PMID: 32850828). Coro1B localizes to the plasma membrane, regulates lamellipodia formation, and when phosphorylated, it can no longer bind ARP2/3 and inhibit its actin nucleation abilities (PMID: 22619279).