CORO6 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CORO6 Polyclonal antibody (17243-1-AP)

• Featured Product
• KD/KO Validated

CORO6 Polyclonal Antibody for WB, ELISA

Cat No. 17243-1-AP Copied!

Publications (5)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, RIP, ELISA

Synonyms

CORO6, coronin 6

• 

  WB analysis using 17243-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17243-1-AP (CORO6 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat skeletal muscle using 17243-1-AP

  rat skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 17243-1-AP (CORO6 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse skeletal muscle using 17243-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 17243-1-AP (CORO6 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 17243-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 17243-1-AP (CORO6 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CORO6 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat skeletal muscle tissue, mouse skeletal muscle tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17243-1-AP targets CORO6 in WB, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11167

  Product name: Recombinant human CORO6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-237 aa of BC064514

  Sequence: MPSPWGWFAVTACGAQRNNFEEPVALQEMDTSNGVLLPFYDPDSSIVYLCGKGDSSIRYFEITDEPPFVHYLNTFSSKEPQRGMGFMPKRGLDVSKCEIARFYKLHERKCEPIIMTVPRKSDLFQDDLYPDTPGPEPALEADEWLSGQDAEPVLISLRDGYVPPKHRELRVTKRNILDVRPPSGPRRSQSASDAPLSQHTLETLLEEIKALRERVQAQEQRITALENMLCELVDGTD

• Full Name: coronin 6
• Calculated Molecular Weight: 237aa,27 kDa; 286aa,32 kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC064514
• Gene Symbol: CORO6
• Gene ID (NCBI): 84940
• RRID: AB_2878368
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6QEF8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Anti-CORO6 (Coronin 6) antibody, catalog number 17243-1-AP, has a total of 5 citations. These appear in Frontiers in Cell and Developmental Biology, Journal of Molecular and Cellular Cardiology, Translational Oncology, Experimental Cell Research, and Journal of Cancer. Research fields include clear cell renal cell carcinoma, cardiomyocyte hypertrophy, osteosarcoma, hepatocellular carcinoma, WNT signaling, m6A RNA modification, and glycolysis. Applications used were primarily Western blot and RIP.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Cell Dev Biol; CORO6 Promotes Cell Growth and Invasion of Clear Cell Renal Cell Carcinoma via Activation of WNT Signaling.; Authors - Xinjun Wang
human	WB	Transl Oncol; USP52 promotes clear cell renal carcinoma progression by deubiquitinating and stabilizing CORO6.; Authors - Xinjun Wang
human,rat	WB	J Mol Cell Cardiol; Remodeling of the m6A landscape in the heart reveals few conserved post-transcriptional events underlying cardiomyocyte hypertrophy.; Authors - Scott A Hinger
human	WB,RIP	Exp Cell Res; METTL3/YTHDF1 stabilizes CORO6 expression promoting osteosarcoma progression through glycolysis; Authors - Xuzhou Liu ; KD Validated
human	WB	J Cancer; Coronin 6 promotes hepatocellular carcinoma progression by enhancing canonical Wnt/beta-catenin signaling pathway.; Authors - Jing Zhang