Tested Applications
| Positive WB detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10611-2-AP targets COX10 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0930 Product name: Recombinant human COX10 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC006394 Sequence: MAASPHTLSSRLLTGCVGGSVWYLERRTIQDSPHKFLHLLRNVNKQWITFQHFSFLKRMYVTQLNRSHNQQVRPKPEPVASPFLEKTSSGQAKAEIYEMRPLSPPSLSLSRKPNEKELIELEPDSVIEDSIDVGKETKEEKRWKEMKLQVYDLPGILAQLSKIKLTALVVSTTAAGFALAPGPFDWPCFLLTSVGTGLASCAANSINQFFEVPFDSNMNRTKNRPLVRGQISPLLAVSFATCCAVPGVAILTLGVNPLTGALGLFNIFLYTCCYTPLKRISIANTWVGAVVGAIPPVMGW Predict reactive species |
| Full Name | COX10 homolog, cytochrome c oxidase assembly protein, heme A: farnesyltransferase (yeast) |
| Calculated Molecular Weight | 51 kDa |
| Observed Molecular Weight | 51 kDa |
| GenBank Accession Number | BC006394 |
| Gene Symbol | COX10 |
| Gene ID (NCBI) | 1352 |
| RRID | AB_2084833 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q12887 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cytochrome c oxidase (COX) is the terminal enzyme in the electron transfer chain located in the mitochondrial inner membrane. It catalyzes the electron transfer from reduced cytochrome c to oxygen. COX10 is predicted to contain 7-9 transmembrane domains, and it is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes heme A:farnesyltransferase, which is required for the expression of functional COX and functions in the maturation of the heme A prosthetic group of COX. In addition, COX10 may play a certain role in the development and progression of azoospermia.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for COX10 antibody 10611-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The COX10 Polyclonal antibody (Cat# 10611-2-AP) has 10 citations across journals including Nature Communications, Nucleic Acids Research, Free Radical Biology and Medicine, EMBO Molecular Medicine, Translational Research, Glia, Journal of Biological Chemistry, and PLoS One. Research fields span mitochondrial respiration, oxidative phosphorylation, tRNA modification, metabolic dysfunction, stem cell differentiation, neurobiology, cardiovascular disease, reproductive biology, and placental biology.
| Species | Application | Title |
|---|---|---|
Nat Commun mTORC1 signaling facilitates differential stem cell differentiation to shape the developing murine lung and is associated with mitochondrial capacity | ||
Nucleic Acids Res A deafness-associated tRNA mutation caused pleiotropic effects on the m1G37 modification, processing, stability and aminoacylation of tRNAIle and mitochondrial translation. | ||
Free Radic Biol Med Mitochondrial and glucose metabolic dysfunctions in granulosa cells induce impaired oocytes of polycystic ovary syndrome through Sirtuin 3. | ||
EMBO Mol Med Expression of the alternative oxidase complements cytochrome c oxidase deficiency in human cells.
| ||
Transl Res Skeletal Muscle MiR-210 Expression is Associated with Mitochondrial Function in Peripheral Artery Disease Patients. |
Reviews
What customers say
The single review for this antibody reports a 5-star rating. The user tested it in Western blot using mouse brain astrocytes at a 1:1000 dilution, with SDS-PAGE, nitrocellulose membrane, and 5% non-fat dry milk blocking. The antibody performed very well and was validated on knockout mice lacking COX10 in brain astrocytes (Aldh1l1-Cre/ERT2::Cox10fl/+), confirming its specificity and reliability for detecting the target protein in both wild-type and knockout samples.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Kateryna (Verified Customer) (01-16-2025) | The antibody worked very well in Western blot (SDS-PAGE, nitrocellulose membrane, 5% non-fat dry milk blocking). The antibody was validated on knockout mice lacking COX10 in brain astrocytes (Aldh1l1-Cre/ERT2::Cox10fl/+).
 |
