• Featured Product
  • KD/KO Validated

COX10 Polyclonal antibody

COX10 Polyclonal Antibody for WB, ELISA
Cat No. 10611-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

COX10, Heme O synthase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10611-2-AP targets COX10 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0930

Product name: Recombinant human COX10 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-300 aa of BC006394

Sequence: MAASPHTLSSRLLTGCVGGSVWYLERRTIQDSPHKFLHLLRNVNKQWITFQHFSFLKRMYVTQLNRSHNQQVRPKPEPVASPFLEKTSSGQAKAEIYEMRPLSPPSLSLSRKPNEKELIELEPDSVIEDSIDVGKETKEEKRWKEMKLQVYDLPGILAQLSKIKLTALVVSTTAAGFALAPGPFDWPCFLLTSVGTGLASCAANSINQFFEVPFDSNMNRTKNRPLVRGQISPLLAVSFATCCAVPGVAILTLGVNPLTGALGLFNIFLYTCCYTPLKRISIANTWVGAVVGAIPPVMGW

Predict reactive species
Full Name COX10 homolog, cytochrome c oxidase assembly protein, heme A: farnesyltransferase (yeast)
Calculated Molecular Weight 51 kDa
Observed Molecular Weight 51 kDa
GenBank Accession NumberBC006394
Gene Symbol COX10
Gene ID (NCBI) 1352
RRIDAB_2084833
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ12887
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cytochrome c oxidase (COX) is the terminal enzyme in the electron transfer chain located in the mitochondrial inner membrane. It catalyzes the electron transfer from reduced cytochrome c to oxygen. COX10 is predicted to contain 7-9 transmembrane domains, and it is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes heme A:farnesyltransferase, which is required for the expression of functional COX and functions in the maturation of the heme A prosthetic group of COX. In addition, COX10 may play a certain role in the development and progression of azoospermia.

Protocols

Product Specific Protocols
WB protocol for COX10 antibody 10611-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nucleic Acids Res

A deafness-associated tRNA mutation caused pleiotropic effects on the m1G37 modification, processing, stability and aminoacylation of tRNAIle and mitochondrial translation.

Authors - Feilong Meng
humanWB

Transl Res

Skeletal Muscle MiR-210 Expression is Associated with Mitochondrial Function in Peripheral Artery Disease Patients.

Authors - Ahmed Ismaeel
humanWB

Nat Commun

Mitochondrial respiration protects against oxygen-associated DNA damage.

Authors - Sung Ho Joong HJ
humanWB

EMBO Mol Med

Expression of the alternative oxidase complements cytochrome c oxidase deficiency in human cells.

Authors - Dassa Emmanuel P EP
  • KD Validated
humanWB

Free Radic Biol Med

Mitochondrial and glucose metabolic dysfunctions in granulosa cells induce impaired oocytes of polycystic ovary syndrome through Sirtuin 3.

Authors - Qing Zhang
mouseWB

Glia

Deficient mitochondrial respiration in astrocytes impairs trace fear conditioning and increases naloxone-precipitated aversion in morphine-dependent mice.

Authors - Kateryna Murlanova
  • KO Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Kateryna (Verified Customer) (01-16-2025)

The antibody worked very well in Western blot (SDS-PAGE, nitrocellulose membrane, 5% non-fat dry milk blocking). The antibody was validated on knockout mice lacking COX10 in brain astrocytes (Aldh1l1-Cre/ERT2::Cox10fl/+).

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse brain astrocytes
COX10 Antibody Western Blot validation (1:1000 dilution) in Mouse brain astrocytes (Cat no:10611-2-AP)
Loading...
||
New chat Able
正在加载,请稍候...