Tested Applications
| Positive WB detected in | MCF-7 cells, rat heart tissue, THP-1 cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11464-1-AP targets COX17 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2032 Product name: Recombinant human COX17 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-63 aa of BC010933 Sequence: MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI Predict reactive species |
| Full Name | COX17 cytochrome c oxidase assembly homolog (S. cerevisiae) |
| Calculated Molecular Weight | 63 aa, 7 kDa |
| Observed Molecular Weight | 7 kDa |
| GenBank Accession Number | BC010933 |
| Gene Symbol | COX17 |
| Gene ID (NCBI) | 10063 |
| RRID | AB_2085109 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q14061 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for COX17 antibody 11464-1-AP | Download protocol |
| IHC protocol for COX17 antibody 11464-1-AP | Download protocol |
| WB protocol for COX17 antibody 11464-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The COX17 Polyclonal antibody (Cat# 11464-1-AP) has 30 citations spanning journals including Cell Stem Cell, Redox Biology, Nucleic Acids Research, Cell Reports, EMBO Molecular Medicine, FASEB Journal, Journal of Biological Chemistry, and Molecular Biology of the Cell, among others. Research fields covered include mitochondrial copper homeostasis, cuproptosis, oxidative phosphorylation, neurodegeneration, cancer, diabetic nephropathy, renal fibrosis, skeletal muscle biology, and mitochondrial respiration.
| Species | Application | Title |
|---|---|---|
Cell Stem Cell Disrupting Mitochondrial Copper Distribution Inhibits Leukemic Stem Cell Self-Renewal.
| ||
J Adv Res Cuproptosis in atrazine-induced hepatotoxicity: ATOX1 as a therapeutic target for lycopene-mediated protection | ||
Redox Biol Lead aggravates Alzheimer's disease pathology via mitochondrial copper accumulation regulated by COX17 | ||
Redox Biol Copper deprivation reprograms antioxidant defense to suppress ferroptosis via SLC7A11. | ||
Nucleic Acids Res Human TRUB1 is a highly conserved pseudouridine synthase responsible for the formation of Ψ55 in mitochondrial tRNAAsn, tRNAGln, tRNAGlu and tRNAPro | ||
Acta Pharmacol Sin COX17 restricts renal fibrosis development by maintaining mitochondrial copper homeostasis and restoring complex IV activity |
