COX18 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• COX18 Polyclonal antibody (18071-1-AP)

COX18 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 18071-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

OXA1L2, Cytochrome c oxidase assembly protein COX18, mitochondrial, COX18Hs

• 

  WB analysis of mouse liver using 18071-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 18071-1-AP (COX18 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 18071-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 18071-1-AP (COX18 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 18071-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 18071-1-AP (COX18 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 18071-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 18071-1-AP (COX18 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 18071-1-AP

  Immunofluorescent analysis of HepG2 cells, using COX18 antibody 18071-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse liver tissue, HeLa cells, NIH/3T3 cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:300-1:600
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18071-1-AP targets COX18 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12709

  Product name: Recombinant human COX18 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 187-333 aa of BC101684

  Sequence: ALRNLSTGAAHSEGFSVQEQLATGGILWFPDLTAPDSTWILPISVGVINLLIVEICALQKIGMSRFQTYITYFVRAMSVLMIPIAATVPSSIVLYWLCSSFVGLSQNLLLRSPGFRQLCRIPSTKSDSETPYKDIFAAFNTKFISRK

• Full Name: COX18 cytochrome c oxidase assembly homolog (S. cerevisiae)
• Calculated Molecular Weight: 333 aa, 37 kDa
• Observed Molecular Weight: 37-40 kDa, 28-30 kDa
• GenBank Accession Number: BC101684
• Gene Symbol: COX18
• Gene ID (NCBI): 285521
• RRID: AB_10638443
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N8Q8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Biochim Biophys Acta; The mitochondrial TMEM177 associates with COX20 during COX2 biogenesis.; Authors - Isotta Lorenzi
human	WB	Cell Stem Cell; Selective translation of nuclear mitochondrial respiratory proteins reprograms succinate metabolism in AML development and chemoresistance; Authors - Guoqiang Han