COX18 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• COX18 Polyclonal antibody (18071-1-AP)

COX18 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 18071-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

OXA1L2, Cytochrome c oxidase assembly protein COX18, mitochondrial, COX18Hs

• 

  WB analysis of mouse liver using 18071-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 18071-1-AP (COX18 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 18071-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 18071-1-AP (COX18 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 18071-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 18071-1-AP (COX18 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 18071-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 18071-1-AP (COX18 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 18071-1-AP

  Immunofluorescent analysis of HepG2 cells, using COX18 antibody 18071-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for COX18 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse liver tissue, HeLa cells, NIH/3T3 cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:300-1:600
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18071-1-AP targets COX18 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12709

  Product name: Recombinant human COX18 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 187-333 aa of BC101684

  Sequence: ALRNLSTGAAHSEGFSVQEQLATGGILWFPDLTAPDSTWILPISVGVINLLIVEICALQKIGMSRFQTYITYFVRAMSVLMIPIAATVPSSIVLYWLCSSFVGLSQNLLLRSPGFRQLCRIPSTKSDSETPYKDIFAAFNTKFISRK

• Full Name: COX18 cytochrome c oxidase assembly homolog (S. cerevisiae)
• Calculated Molecular Weight: 333 aa, 37 kDa
• Observed Molecular Weight: 37-40 kDa, 28-30 kDa
• GenBank Accession Number: BC101684
• Gene Symbol: COX18
• Gene ID (NCBI): 285521
• RRID: AB_10638443
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N8Q8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The COX18 Polyclonal antibody (Cat# 18071-1-AP) has 2 citations. These appear in Cell Stem Cell and Biochimica et Biophysica Acta. The cited research spans two fields: one study investigates succinate metabolism reprogramming in acute myeloid leukemia development and chemoresistance, while the other examines mitochondrial COX2 biogenesis involving TMEM177. Both citations used the antibody for Western blot in human samples.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Stem Cell; Selective translation of nuclear mitochondrial respiratory proteins reprograms succinate metabolism in AML development and chemoresistance; Authors - Guoqiang Han
human	WB	Biochim Biophys Acta; The mitochondrial TMEM177 associates with COX20 during COX2 biogenesis.; Authors - Isotta Lorenzi