COX18 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84377-3-RR (same clone as 84377-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84377-3-RR (COX18 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84377-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84377-3-RR

  Biolayer interferometry (BLl) kinetic assays of 84377-3-RR against Human COX18 were performed. The affinity constant is 11.0 nM.

COX18 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84377-3-PBS

Clone No.241359G7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

OXA1L2, Cytochrome c oxidase assembly protein COX18, mitochondrial, COX18Hs, 241359G7

---

Product Information

84377-3-PBS targets COX18 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag12709

  Product name: Recombinant human COX18 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 187-333 aa of BC101684

  Sequence: ALRNLSTGAAHSEGFSVQEQLATGGILWFPDLTAPDSTWILPISVGVINLLIVEICALQKIGMSRFQTYITYFVRAMSVLMIPIAATVPSSIVLYWLCSSFVGLSQNLLLRSPGFRQLCRIPSTKSDSETPYKDIFAAFNTKFISRK

• Full Name: COX18 cytochrome c oxidase assembly homolog (S. cerevisiae)
• Calculated Molecular Weight: 333 aa, 37 kDa
• Observed Molecular Weight: 37-40 kDa, 28-30 kDa
• GenBank Accession Number: BC101684
• Gene Symbol: COX18
• Gene ID (NCBI): 285521
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q8N8Q8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.