COX4NB Polyclonal antibody

COX4NB Polyclonal Antibody for WB, ELISA

Cat No. 19889-1-AP

Publications (4)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

EMC8, C16orf2, C16orf4, COX4 neighbor, COX4AL

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis of mouse pancreas using 19889-1-AP
mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 19889-1-AP (COX4NB Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of human placenta using 19889-1-AP
human placenta tissue were subjected to SDS PAGE followed by western blot with 19889-1-AP (COX4NB Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse liver using 19889-1-AP
mouse liver tissue were subjected to SDS PAGE followed by western blot with 19889-1-AP (COX4NB Antibody) at dilution of 1:300 incubated at 4 degree celsius over night.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of human placenta using 19889-1-AP
human placenta tissue were subjected to SDS PAGE followed by western blot with 19889-1-AP (COX4NB Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of COLO 320 using 19889-1-AP
COLO 320 cells were subjected to SDS PAGE followed by western blot with 19889-1-AP (COX4NB Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary cancer using 19889-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 19889-1-AP (COX4NB antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human placenta using 19889-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 19889-1-AP (COX4NB antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse kidney using 19889-1-AP
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 19889-1-AP (COX4NB antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat liver using 19889-1-AP
Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 19889-1-AP (COX4NB antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for COX4NB in ?

Overview

Tested Applications
Product Information
Publications (4)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in

mouse pancreas tissue, COLO 320 cells, human placenta tissue, mouse liver tissue

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:200-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

19889-1-AP targets COX4NB in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag13720 Product name: Recombinant human COX4NB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-210 aa of BC001472 Sequence: MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC Predict reactive species
Full Name	COX4 neighbor
Calculated Molecular Weight	210 aa, 24 kDa
Observed Molecular Weight	24 kDa
GenBank Accession Number	BC001472
Gene Symbol	COX4NB
Gene ID (NCBI)	10328
RRID	AB_2878618
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O43402
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
WB protocol for COX4NB antibody 19889-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The COX4NB Polyclonal antibody (Cat# 19889-1-AP) has a total of 4 citations. These appear in Nature Methods, Molecular Cell, PLoS Pathogens, and bioRxiv. The associated research fields include endogenous protein disorder analysis, ER membrane protein complex (EMC) assembly, Dengue virus membrane fusion, and multi-bundle membrane protein biogenesis. Applications cited are Western blot and immunoprecipitation.

Species	Application	Title
mouse	WB	Nat Methods Global analysis of endogenous protein disorder in cells Authors - Shouxiang Zhang View Article
	IP	Mol Cell WNK1 is an assembly factor for the human ER membrane protein complex. Authors - Tino Pleiner View Article
human	WB	PLoS Pathog A specific EMC subunit supports Dengue virus infection by promoting virus membrane fusion essential for cytosolic genome delivery. Authors - Parikshit Bagchi View Article
human	WB	bioRxiv The ER membrane protein complex acts as a chaperone to promote the biogenesis of multi-bundle membrane proteins. Authors - Marinda Stanton View Article