Tested Applications
| Positive WB detected in | HeLa cells, L02 cells, mouse liver tissue, rat liver tissue |
| Positive IHC detected in | human ovary cancer tissue, rat brain tissue, mouse stomach tissue, rat stomach tissue, human thyroid cancer tissue, mouse skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11418-2-AP targets COX5B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, monkey, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1986 Product name: Recombinant human COX5B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-129 aa of BC006229 Sequence: MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH Predict reactive species |
| Full Name | cytochrome c oxidase subunit Vb |
| Calculated Molecular Weight | 129 aa, 14 kDa |
| Observed Molecular Weight | 14 kDa |
| GenBank Accession Number | BC006229 |
| Gene Symbol | COX5B |
| Gene ID (NCBI) | 1329 |
| RRID | AB_2245376 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P10606 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
COX5B belongs to the cytochrome c oxidase subunit 5B family. It is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. COX5B and other 3 genes CKB, HBB, MBP are involved in respiration.(PMID:21295140)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for COX5B antibody 11418-2-AP | Download protocol |
| IHC protocol for COX5B antibody 11418-2-AP | Download protocol |
| WB protocol for COX5B antibody 11418-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-COX5B antibody (Cat# 11418-2-AP) has 23 citations published in high-impact journals including Nature, Cell, Cancer Cell, Cell Metabolism, Nature Immunology, Molecular Cell, PNAS, and Journal of Biological Chemistry. Research fields encompass mitochondrial respiratory chain biology, oncology (pancreatic cancer, lung adenocarcinoma, glioma, multiple myeloma), neurology (vascular dementia, depression, sepsis-associated encephalopathy), immunology, ferroptosis, and metabolic regulation across human, mouse, monkey, and goat species.
| Species | Application | Title |
|---|---|---|
Cancer Cell Tumor cell-intrinsic epigenetic dysregulation shapes cancer-associated fibroblasts heterogeneity to metabolically support pancreatic cancer | ||
Cell Mitochondrial Protein Synthesis Adapts to Influx of Nuclear-Encoded Protein.
| ||
Cell Metab Enhanced Respiratory Chain Supercomplex Formation in Response to Exercise in Human Skeletal Muscle. | ||
Nat Immunol Mitochondrial respiratory-chain adaptations in macrophages contribute to antibacterial host defense. |
Reviews
What customers say
One reviewer (Süleyman Bozkurt) gave this antibody a 5-star rating after using it on HeLa cells by Western Blot at a 1:1000 dilution (Lot 00084945). They noted that while some non-specific bands were present, they were far from the target band, making the antibody highly specific overall. The reviewer recommended the product.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Süleyman (Verified Customer) (02-07-2022) | HeLa cell line is used and even though it has some unspecific bands but it is very specific and the unspecific bands are very distant. Recommended!
 |
