COX6A1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• COX6A1 Polyclonal antibody (11460-1-AP)

• Featured Product
• KD/KO Validated

COX6A1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11460-1-AP Copied!

Publications (16)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

COX VIa L, COX VIa-L, COX6AL, Cytochrome c oxidase polypeptide VIa-liver, Cytochrome c oxidase subunit VIA-liver

• 

  WB analysis using 11460-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11460-1-AP (COX6A1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 11460-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 11460-1-AP (COX6A1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 11460-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 11460-1-AP (COX6A1 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 11460-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 11460-1-AP (COX6A1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 11460-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11460-1-AP (COX6A1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 11460-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 11460-1-AP (COX6A1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse stomach using 11460-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 11460-1-AP (COX6A1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat kidney using 11460-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 11460-1-AP (COX6A1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat salivary gland using 11460-1-AP

  Immunohistochemical analysis of paraffin-embedded rat salivary gland tissue slide using 11460-1-AP (COX6A1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat stomach using 11460-1-AP

  Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 11460-1-AP (COX6A1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 11460-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11460-1-AP (COX6A1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 11460-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 11460-1-AP (COX6A1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 11460-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 11460-1-AP (COX6A1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 11460-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 11460-1-AP (COX6A1 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 11460-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using COX6A1 antibody (11460-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of SH-SY5Y using 11460-1-AP

  Immunofluorescent analysis of (4% PFA) fixed SH-SY5Y cells using 11460-1-AP (COX6A1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for COX6A1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse liver tissue, NIH/3T3 cells, rat liver tissue
• Positive IHC detected in: human pancreas cancer tissue, mouse kidney tissue, rat stomach tissue, human colon cancer tissue, rat kidney tissue, mouse stomach tissue, human kidney tissue, rat salivary gland tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells, SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11460-1-AP targets COX6A1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2006

  Product name: Recombinant human COX6A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-109 aa of BC007723

  Sequence: MAVVGVSSVSRLLGRSRPQLGRPMSSGAHGEEGSARMWKTLTFFVALPGVAVSMLNVYLKSHHGEHERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYEDE

• Full Name: cytochrome c oxidase subunit VIa polypeptide 1
• Calculated Molecular Weight: 85 aa, 9 kDa
• Observed Molecular Weight: 9.5 kDa
• GenBank Accession Number: BC007723
• Gene Symbol: COX6A1
• Gene ID (NCBI): 1337
• RRID: AB_2085445
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P12074
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COX6A1(Cytochrome c oxidase subunit 6A1, mitochondrial) is also named as COX6AL and belongs to the cytochrome c oxidase subunit 6A family.This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.

Publications

What published studies show

The COX6A1 Polyclonal antibody (Cat# 11460-1-AP) has 16 citations across 14 journals including Nature Communications, Autophagy, Cell Death & Disease, Cell Reports, Molecular & Cellular Proteomics, FASEB Journal, Journal of Biological Chemistry, Human Molecular Genetics, eLife, and Neurobiology of Disease. Research fields span mitochondrial oxidative phosphorylation, Complex IV assembly, hepatotoxicity, platelet function, cardiomyopathy, cancer chemoresistance, neurodegeneration, and sperm biology.

Automatically generated from the 16 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB,IF	Autophagy; PLK1 (polo like kinase 1)-dependent autophagy facilitates gefitinib-induced hepatotoxicity by degrading COX6A1 (cytochrome c oxidase subunit 6A1).; Authors - Peihua Luo ; KD Validated
mouse	WB	Nat Commun; MTH1 protects platelet mitochondria from oxidative damage and regulates platelet function and thrombosis; Authors - Yangyang Ding
human	WB	Cell Death Dis; The ALDH2/PolG2 axis enhances mitochondrial biogenesis via transcriptional regulation of Nrf2 and promotes chemotherapy resistance in acute myeloid leukaemia.; Authors - Xiuying Hu
human	WB	Cell Death Dis; O-GlcNAcylation on Rab3A attenuates its effects on mitochondrial oxidative phosphorylation and metastasis in hepatocellular carcinoma.; Authors - Weicheng Wu
mouse	WB	Cell Rep; Mutant CHCHD10 causes an extensive metabolic rewiring that precedes OXPHOS dysfunction in a murine model of mitochondrial cardiomyopathy.; Authors - Nicole M Sayles
human	WB	Mol Cell Proteomics; HIGD2A is Required for Assembly of the COX3 Module of Human Mitochondrial Complex IV.; Authors - Daniella H Hock