COX6A1 Polyclonal antibody

• 

  WB analysis using 11460-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11460-1-AP (COX6A1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 11460-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 11460-1-AP (COX6A1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human pancreas cancer using 11460-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 11460-1-AP (COX6A1 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human pancreas cancer using 11460-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 11460-1-AP (COX6A1 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IF Staining of MCF-7 using 11460-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using COX6A1 antibody (11460-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  IF Staining of SH-SY5Y using 11460-1-AP

  Immunofluorescent analysis of (4% PFA) fixed SH-SY5Y cells using 11460-1-AP (COX6A1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

COX6A1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11460-1-AP

Publications(14)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

COX VIa L, COX VIa-L, COX6AL, Cytochrome c oxidase polypeptide VIa-liver, Cytochrome c oxidase subunit VIA-liver

---

Tested Applications

• Positive WB detected in: mouse liver tissue, NIH/3T3 cells, rat liver tissue
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells, SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 14 publications below
• IF: See 1 publications below

Product Information

11460-1-AP targets COX6A1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2006

  Product name: Recombinant human COX6A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-109 aa of BC007723

  Sequence: MAVVGVSSVSRLLGRSRPQLGRPMSSGAHGEEGSARMWKTLTFFVALPGVAVSMLNVYLKSHHGEHERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYEDE

• Full Name: cytochrome c oxidase subunit VIa polypeptide 1
• Calculated Molecular Weight: 85 aa, 9 kDa
• Observed Molecular Weight: 9.5 kDa
• GenBank Accession Number: BC007723
• Gene Symbol: COX6A1
• Gene ID (NCBI): 1337
• RRID: AB_2085445
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P12074
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COX6A1(Cytochrome c oxidase subunit 6A1, mitochondrial) is also named as COX6AL and belongs to the cytochrome c oxidase subunit 6A family.This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB,IF	Autophagy; PLK1 (polo like kinase 1)-dependent autophagy facilitates gefitinib-induced hepatotoxicity by degrading COX6A1 (cytochrome c oxidase subunit 6A1).; Authors - Peihua Luo ; KD Validated
human	WB	Elife; Function of hTim8a in complex IV assembly in neuronal cells provides insight into pathomechanism underlying Mohr-Tranebjærg syndrome.; Authors - Yilin Kang
human	WB	Cell Death Dis; O-GlcNAcylation on Rab3A attenuates its effects on mitochondrial oxidative phosphorylation and metastasis in hepatocellular carcinoma.; Authors - Weicheng Wu
human	WB	Mol Cell Proteomics; HIGD2A is Required for Assembly of the COX3 Module of Human Mitochondrial Complex IV; Authors - Daniella H Hock
mouse	WB	Hum Mol Genet; Pathological characterization of a novel mouse model expressing the PD-linked CHCHD2-T61I mutation.; Authors - Teresa R Kee
human	WB	Mol Cell Proteomics; HIGD2A is Required for Assembly of the COX3 Module of Human Mitochondrial Complex IV.; Authors - Daniella H Hock