COX6B1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86783-3-RR (same clone as 86783-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86783-3-RR (COX6B1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86783-3-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 86783-3-RR (same clone as 86783-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using COX6B1 antibody (86783-3-RR, Clone: 251743G4 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86783-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86783-3-RR

  Biolayer interferometry (BLl) kinetic assays of 86783-3-RR against Human COX6B1 were performed. The affinity constant is 1.18 nM.

COX6B1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86783-3-PBS

Clone No.251743G4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

COX VIb 1, COX VIb-1, COX6B

---

Product Information

86783-3-PBS targets COX6B1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1984

  Product name: Recombinant human COX6B1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-86 aa of BC001015

  Sequence: MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI

• Full Name: cytochrome c oxidase subunit Vib polypeptide 1 (ubiquitous)
• Calculated Molecular Weight: 80 aa, 10 kDa
• Observed Molecular Weight: 10-13 kDa
• GenBank Accession Number: BC001015
• Gene Symbol: COX6B1
• Gene ID (NCBI): 1340
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P14854
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

COX6B1 (Cytochrome c oxidase subunit 6B1) is also named as COX6B and belongs to the cytochrome c oxidase subunit 6B family. It connects the two COX monomers into the physiological dimeric form. Defects in COX6B1 are a cause of mitochondrial complex IV deficiency (MT-C4D).