COX6B2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of mouse testis using 83164-3-RR (same clone as 83164-3-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 83164-3-RR (COX6B2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83164-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83164-3-RR

  Biolayer interferometry (BLl) kinetic assays of 83164-3-RR against Human COX6B2 were performed. The affinity constant is 11.7 nM.

COX6B2 Uni-rAb^® Recombinant Antibody for ELISA, WB

Cat No. 83164-3-PBS

Clone No.230497H6

Host / Isotype

Rabbit / IgG

Reactivity

mouse, human

Applications

ELISA, WB

Synonyms

Cytochrome c oxidase subunit VIb, testis-specific isoform, Cytochrome c oxidase subunit 6B2, COX VIb-2, 230497H6

---

Product Information

83164-3-PBS targets COX6B2 in ELISA, WB applications and shows reactivity with mouse, human samples.

• Tested Reactivity: mouse, human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1983

  Product name: Recombinant human COX6B2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-88 aa of BC064548

  Sequence: MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPISWVESWNEQIKNGIFAGKI

• Full Name: cytochrome c oxidase subunit VIb polypeptide 2 (testis)
• Calculated Molecular Weight: 88 aa, 11 kDa
• GenBank Accession Number: BC064548
• Gene Symbol: COX6B2
• Gene ID (NCBI): 125965
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q6YFQ2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.