COX7B Polyclonal antibody

• 

  WB analysis using 11417-2-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11417-2-AP (COX7B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 11417-2-AP

  WB result of COX7B antibody (11417-2-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-COX7B transfected MCF-7 cells.

• 

  IHC staining of mouse heart using 11417-2-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 11417-2-AP (COX7B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 11417-2-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 11417-2-AP (COX7B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

COX7B Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11417-2-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

COX7B

---

Tested Applications

• Positive WB detected in: mouse brain tissue, MCF-7 cells, rat brain tissue
• Positive IHC detected in: mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below

Product Information

11417-2-AP targets COX7B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1988

  Product name: Recombinant human COX7B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-80 aa of BC018386

  Sequence: MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQVGIEWNLSPVGRVTPKEWRNQ

• Full Name: cytochrome c oxidase subunit VIIb
• Calculated Molecular Weight: 80 aa, 9 kDa
• Observed Molecular Weight: 9 kDa
• GenBank Accession Number: BC018386
• Gene Symbol: COX7B
• Gene ID (NCBI): 1349
• RRID: AB_2085709
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P24311
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COX7B, also named as Cytochrome c oxidase subunit 7B, mitochondrial, is a 80 amino acid protein, which belongs to the cytochrome c oxidase VIIb family. COX7B protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. COX7B plays a role in proper central nervous system development in vertebrates. COX7B as a terminal enzyme in the mitochondrial respiratory chain (oxidative phosphorylation OXPHOS), catalyzing the electron transfer from reduced cytochrome c to molecule oxygen and plays a role in eye development.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Nutr Biochem; Deficiency of β-carotene oxygenase 2 induces mitochondrial fragmentation and activates the STING-IRF3 pathway in the mouse hypothalamus.; Authors - Lei Wu
human	WB	J Biol Chem; PMID: 20870728; Authors - Oliva Claudia R CR
human	WB	Arch Biochem Biophys; Knockdown of ABCB7 inhibits esophageal cancer progression by inhibiting the TGF-β/Smad signaling; Authors - Shiyun Feng
human	WB	Cell Stem Cell; Selective translation of nuclear mitochondrial respiratory proteins reprograms succinate metabolism in AML development and chemoresistance; Authors - Guoqiang Han