COX7C Polyclonal antibody

• Home
• Products
• Primary Antibodies
• COX7C Polyclonal antibody (11411-2-AP)

• Featured Product
• KD/KO Validated

COX7C Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11411-2-AP Copied!

Publications (16)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Cytochrome c oxidase subunit 7C, mitochondrial

• 

  WB analysis using 11411-2-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11411-2-AP (COX7C antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 11411-2-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas using 11411-2-AP (COX7C antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 11411-2-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 11411-2-AP (COX7C antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 11411-2-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 11411-2-AP (COX7C antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse pancreas using 11411-2-AP

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 11411-2-AP (COX7C antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat cerebellum using 11411-2-AP

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 11411-2-AP (COX7C antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat pancreas using 11411-2-AP

  Immunohistochemical analysis of paraffin-embedded rat pancreas tissue slide using 11411-2-AP (COX7C antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 11411-2-AP

  Immunofluorescent analysis of MCF-7 cells, using COX7C antibody 11411-2-AP at 1:50 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for COX7C in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse heart tissue, mouse skeletal muscle tissue. rat skeletal muscle tissue
• Positive IHC detected in: human gliomas tissue, human pancreas cancer tissue, mouse liver tissue, rat pancreas tissue, rat cerebellum tissue, mouse pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11411-2-AP targets COX7C in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1989

  Product name: Recombinant human COX7C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-63 aa of BC007498

  Sequence: MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLKT

• Full Name: cytochrome c oxidase subunit VIIc
• Calculated Molecular Weight: 63 aa, 7 kDa
• Observed Molecular Weight: 15~28 kDa
• GenBank Accession Number: BC007498
• Gene Symbol: COX7C
• Gene ID (NCBI): 1350
• RRID: AB_2085713
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P15954
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. COX7C (Cytochrome c oxidase subunit 7C, mitochondrial) is one of the subunits, catalyzing the elctron transfer from reduced cytochrome c to molecule oxygen. This protein belongs to the cytochrome c oxidase VIIc family. The calculated molecular weight of COX7C is 7 kDa, but due to the presence of the complex, a complex form of 28 kDa may also be observed.

Publications

What published studies show

Anti-COX7C (Cat# 11411-2-AP) has 16 citations published in journals including Nature Communications, Acta Pharmaceutica Sinica B, Cell Reports Medicine, Cell Death & Disease, Analytical Chemistry, Frontiers in Immunology, Pain, Journal of Biological Chemistry, and others. Research fields span mitochondrial oxidative phosphorylation, liver injury, neurodegeneration, cancer (hepatocellular carcinoma, melanoma, breast cancer, glioma), rheumatoid arthritis, pain perception, coronary artery disease, and cerebral ischemia/reperfusion injury.

Automatically generated from the 16 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Commun; ZHX2 emerges as a negative regulator of mitochondrial oxidative phosphorylation during acute liver injury; Authors - Yankun Zhang
mouse	WB,IF	Acta Pharm Sin B; High glucose induces hippocampal neuron impairment through the SKP1/COX7C pathway: A potential mechanism for perimenopausal depression.; Authors - Ziqi Wang
human	WB	Cell Rep Med; Proteomics landscape of early T-cell precursor acute lymphoblastic leukemia reveals deficient oxidative phosphorylation signatures.; Authors - Miaomiao Liu
human	WB	Cell Death Dis; O-GlcNAcylation on Rab3A attenuates its effects on mitochondrial oxidative phosphorylation and metastasis in hepatocellular carcinoma.; Authors - Weicheng Wu
mouse	IF	Anal Chem; Quantitative Mass Spectrometry Imaging of Intact Proteins in Tissues.; Authors - Mushfeqa Iqfath
rat	IHC	Front Immunol; Integrated analysis of the relationship between metabolic pathways and immune infiltration in rheumatoid arthritis.; Authors - Chaofeng Zhang