Tested Applications
| Positive WB detected in | mouse skeletal muscle tissue, human skeletal muscle tissue |
| Positive IHC detected in | mouse heart tissue, human hepatocirrhosis tissue, rat heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15368-1-AP targets COX8A in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2885 Product name: Recombinant human COX8A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-69 aa of BC063025 Sequence: MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILSHLETYRRPE Predict reactive species |
| Full Name | cytochrome c oxidase subunit 8A (ubiquitous) |
| Calculated Molecular Weight | 8 kDa |
| Observed Molecular Weight | 8 kDa |
| GenBank Accession Number | BC063025 |
| Gene Symbol | COX8A |
| Gene ID (NCBI) | 1351 |
| RRID | AB_10697832 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P10176 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
COX8A(Cytochrome c oxidase subunit 8A) is also named as COX8, COX8L and belongs to the cytochrome c oxidase VIII family. This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. The gene encodes a full length protein of 8 kDa with a transit peptide of 25 amino acid.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for COX8A antibody 15368-1-AP | Download protocol |
| WB protocol for COX8A antibody 15368-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The COX8A Polyclonal antibody (catalog #15368-1-AP) has 6 total citations. These appear in journals including Nature Communications, Journal of Advanced Research, Cell Death & Disease, Pharmacological Research, Basic Research in Cardiology, and Journal of Proteomics. The associated research fields span mitochondrial respiration and muscle performance, ovarian follicular development, hepatocellular carcinoma metastasis, gastric cancer chemotherapy sensitivity, cardiac mitochondrial changes, and prostate cancer protein imaging.
| Species | Application | Title |
|---|---|---|
Nat Commun A FRET-based respirasome assembly screen identifies spleen tyrosine kinase as a target to improve muscle mitochondrial respiration and exercise performance in mice | ||
J Adv Res Lactational high weight loss impairs follicular development by causing mitochondrial dysfunction of ovarian cells in sows and mitigated by butyrate supplement | ||
Pharmacol Res Discovery of KMT5A repressed miR-99b cluster with potential to restore chemotherapy sensitivity in gastric cancer by regulating mitochondrial complex II and affecting OXPHOS. | ||
Cell Death Dis O-GlcNAcylation on Rab3A attenuates its effects on mitochondrial oxidative phosphorylation and metastasis in hepatocellular carcinoma. | ||
Basic Res Cardiol Comparison of the stage-dependent mitochondrial changes in response to pressure overload between the diseased right and left ventricle in the rat | ||
J Proteomics MALDI-MS tissue imaging identification of biliverdin reductase B overexpression in prostate cancer. |
Reviews
What customers say
The single review rates the product 5 stars for Western Blot. The user transfected HEK293t cells with Cox8-eGFP, collected mitochondria 48 hours later, and loaded 10 µg of mitochondrial lysate (in RIPA buffer) per lane. The primary anti-Cox8 antibody was incubated overnight at 4°C at a 1:1000 dilution. The resulting blot clearly distinguished the transfected sample from the no-transfection control, confirming the antibody's specificity and effectiveness for detecting Cox8 in mitochondrial preparations.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Svitlana (Verified Customer) (03-01-2019) | HEK293t transfected with Cox8-eGFP, 48 hours post-transfection cells collected for mitochondria isolation. 10 ug mitochondrial lysate (in RIPA buffer) was loaded per line.Incubation with primary anti-Cox8 antibody overnight at 4C.Image: 1st line protein ladder, 2nd line no-transfection sample, 3rd line Cox8-eGFP transfected sample.
 |
