COXIV Monoclonal antibody, PBS Only (Capture)

COXIV Monoclonal Antibody for Cytometric bead array, Indirect ELISA
Cat No. 60251-1-PBS
Clone No.3C7D2

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

COX4I1, 3C7D2, COX IV-1, COX4, Cytochrome c oxidase subunit 4 isoform 1, mitochondrial

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60251-1-PBS targets COXIV as part of a matched antibody pair:

MP50551-2: 60251-1-PBS capture and 60251-3-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag20551

Product name: Recombinant human COXIV protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-169 aa of BC021236

Sequence: MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK

Predict reactive species
Full Name cytochrome c oxidase subunit IV isoform 1
Calculated Molecular Weight19.6 kDa
Observed Molecular Weight 17-18 kDa
GenBank Accession NumberBC021236
Gene Symbol COX IV
Gene ID (NCBI) 1327
RRIDAB_2881372
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP13073
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

COX4I1, also named as COX4 and COXIV-1, belongs to the cytochrome c oxidase IV family. It is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. COX4I1 is a marker for mitochondria. It has two isoforms (isoform 1 and 2). Isoform 1(COX4I1) is ubiquitously expressed and isoform 2 is highly expressed in lung tissues. COX4I1 is commonly used as a loading control. This antibody is specific to COX4I1 and do not cross reacts with COX4I2.

Loading...
||
New chat Able
正在加载,请稍候...