Filter:
  • Western Blot (WB) analysis of various lysates using COXIV Monoclonal antibody (66110-1-Ig)

    WB analysis using 66110-1-Ig

    Various lysates were subjected to SDS PAGE followed by western blot with 66110-1-Ig (COXIV antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

  • Western Blot (WB) analysis of various lysates using COXIV Monoclonal antibody (66110-1-Ig)

    WB analysis using 66110-1-Ig

    Various lysates were subjected to SDS PAGE followed by western blot with 66110-1-Ig (COXIV antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of HeLa cells using COXIV Monoclonal antibody (66110-1-Ig)

    WB analysis of HeLa using 66110-1-Ig

    HeLa cells were subjected to SDS PAGE followed by western blot with 66110-1-Ig (COXIV antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  • Immunohistochemistry (IHC) staining of human prostate cancer tissue using COXIV Monoclonal antibody (66110-1-Ig)

    IHC staining of human prostate cancer using 66110-1-Ig

    Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66110-1-Ig (COXIV antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of human prostate cancer tissue using COXIV Monoclonal antibody (66110-1-Ig)

    IHC staining of human prostate cancer using 66110-1-Ig

    Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66110-1-Ig (COXIV antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of human prostate cancer tissue using COXIV Monoclonal antibody (66110-1-Ig)

    IHC staining of human prostate cancer using 66110-1-Ig

    Immunohistochemical analysis of paraffin-embedded human prostate cancer using 66110-1-Ig(COXIV antibody) at dilution of 1:200 (under 10x lens).

  • Immunohistochemistry (IHC) staining of human prostate cancer tissue using COXIV Monoclonal antibody (66110-1-Ig)

    IHC staining of human prostate cancer using 66110-1-Ig

    Immunohistochemical analysis of paraffin-embedded human prostate cancer using 66110-1-Ig(COXIV antibody) at dilution of 1:200 (under 40x lens).

  • Immunohistochemistry (IHC) staining of human pancreas tissue using COXIV Monoclonal antibody (66110-1-Ig)

    IHC staining of human pancreas using 66110-1-Ig

    Immunohistochemical analysis of paraffin-embedded human pancreas using 66110-1-Ig(COXIV antibody) at dilution of 1:100 (under 10x lens).

  • Immunohistochemistry (IHC) staining of human pancreas tissue using COXIV Monoclonal antibody (66110-1-Ig)

    IHC staining of human pancreas using 66110-1-Ig

    Immunohistochemical analysis of paraffin-embedded human pancreas using 66110-1-Ig(COXIV antibody) at dilution of 1:100 (under 40x lens).

  • Immunohistochemistry (IHC) staining of human pancreas tissue using COXIV Monoclonal antibody (66110-1-Ig)

    IHC staining of human pancreas using 66110-1-Ig

    Immunohistochemical analysis of paraffin-embedded human pancreas using 66110-1-Ig(COXIV antibody) at dilution of 1:200 (under 10x lens).

  • Immunohistochemistry (IHC) staining of human pancreas tissue using COXIV Monoclonal antibody (66110-1-Ig)

    IHC staining of human pancreas using 66110-1-Ig

    Immunohistochemical analysis of paraffin-embedded human pancreas using 66110-1-Ig(COXIV antibody) at dilution of 1:200 (under 40x lens).

  • Immunohistochemistry (IHC) staining of human heart tissue using COXIV Monoclonal antibody (66110-1-Ig)

    IHC staining of human heart using 66110-1-Ig

    Immunohistochemical analysis of paraffin-embedded human heart using 66110-1-Ig(COXIV antibody) at dilution of 1:100 (under 10x lens).

  • Immunohistochemistry (IHC) staining of human heart tissue using COXIV Monoclonal antibody (66110-1-Ig)

    IHC staining of human heart using 66110-1-Ig

    Immunohistochemical analysis of paraffin-embedded human heart using 66110-1-Ig(COXIV antibody) at dilution of 1:100 (under 40x lens).

  • Immunohistochemistry (IHC) staining of human heart tissue using COXIV Monoclonal antibody (66110-1-Ig)

    IHC staining of human heart using 66110-1-Ig

    Immunohistochemical analysis of paraffin-embedded human heart using 66110-1-Ig(COXIV antibody) at dilution of 1:200 (under 10x lens).

  • Immunohistochemistry (IHC) staining of human heart tissue using COXIV Monoclonal antibody (66110-1-Ig)

    IHC staining of human heart using 66110-1-Ig

    Immunohistochemical analysis of paraffin-embedded human heart using 66110-1-Ig(COXIV antibody) at dilution of 1:200 (under 40x lens).

"COXIV Antibodies" Comparison

View side-by-side comparison of COXIV antibodies from other vendors to find the one that best suits your research needs.

COXIV Monoclonal antibody

COXIV Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66110-1-Ig
Clone No.2A7B2

Host / Isotype

Mouse / IgG1

Reactivity

human and More (2)

Applications

WB, IHC, IF, IP, ELISA

COX4I1, 2A7B2, COX IV-1, COX4, Cytochrome c oxidase subunit 4 isoform 1, mitochondrial

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, LNCaP cells, K-562 cells
Positive IHC detected inhuman prostate cancer tissue, human pancreas tissue, human heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66110-1-Ig targets COXIV in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag20551

Product name: Recombinant human COXIV protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-169 aa of BC021236

Sequence: MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK

Predict reactive species
Full Name cytochrome c oxidase subunit IV isoform 1
Calculated Molecular Weight19.6 kDa
Observed Molecular Weight 17-18 kDa
GenBank Accession NumberBC021236
Gene Symbol COX IV
Gene ID (NCBI) 1327
RRIDAB_2881509
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP13073
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COX4I1, also named as COX4 and COXIV-1, belongs to the cytochrome c oxidase IV family. It is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. COX4I1 is a marker for mitochondria. It has two isoforms (isoform 1 and 2). Isoform 1(COX4I1) is ubiquitously expressed and isoform 2 is highly expressed in lung tissues. COX4I1 is commonly used as a loading control. This antibody is specific to COX4I1 and do not cross reacts with COX4I2.

Protocols

Product Specific Protocols
IHC protocol for COXIV antibody 66110-1-IgDownload protocol
WB protocol for COXIV antibody 66110-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Science

Structural insight into the SAM-mediated assembly of the mitochondrial TOM core complex.

Authors - Qiang Wang

Nat Immunol

Dynamic mitochondrial transcription and translation in B cells control germinal center entry and lymphomagenesis

Authors - Yavuz F Yazicioglu
humanWB

ACS Nano

Mitochondria-Targeting Polymer Micelle of Dichloroacetate Induced Pyroptosis to Enhance Osteosarcoma Immunotherapy.

Authors - Jiakang Jin
humanWB

Nat Cell Biol

Mitochondria-localised ZNFX1 functions as a dsRNA sensor to initiate antiviral responses through MAVS.

Authors - Yao Wang
humanWB

Mol Cell

Global mitochondrial protein import proteomics reveal distinct regulation by translation and translocation machinery

Authors - Jasmin Adriana Schafer
ratWB

Microbiome

The microbiota-gut-brain axis participates in chronic cerebral hypoperfusion by disrupting the metabolism of short-chain fatty acids.

Authors - Weiping Xiao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Pooja (Verified Customer) (09-08-2025)

worked well in Mouse retina cryosection incubated with 1:100 CoxIV antibody at 4 degree overnight. Recommended.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Mouse retina
FH

Bryce (Verified Customer) (02-18-2022)

Decent loading control for mitochondria. I cut the blot too low, but you get the point.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse Kidney
COXIV Antibody Western Blot validation (1:1000 dilution) in Mouse Kidney (Cat no:66110-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...