COXIV Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of HepG2 using 82916-1-RR (same clone as 82916-1-PBS)

  WB result of COXIV antibody (82916-1-RR; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-COXIV transfected HepG2 cells. This data was developed using the same antibody clone with 82916-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 82916-1-RR (same clone as 82916-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82916-1-RR (COXIV antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82916-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 82916-1-RR (same clone as 82916-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82916-1-RR (COXIV antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82916-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 82916-1-RR (same clone as 82916-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82916-1-RR (COXIV antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82916-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 82916-1-RR (same clone as 82916-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human normal stomach slide using 82916-1-RR (COXIV antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82916-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 82916-1-RR (same clone as 82916-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 82916-1-RR (COXIV antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82916-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovarian cancer using 82916-1-RR (same clone as 82916-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovarian cancer slide using 82916-1-RR (COXIV antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82916-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 82916-1-RR (same clone as 82916-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using COXIV antibody (82916-1-RR, Clone: 3K20 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 82916-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 82916-1-RR (same clone as 82916-1-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug COXIV Recombinant antibody (82916-1-RR, Clone:3K20) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 82916-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82916-1-RR

  Biolayer interferometry (BLl) kinetic assays of 82916-1-RR against Human COXIV were performed. The affinity constant is 9.41 nM.

• Featured Product
• KD/KO Validated

COXIV Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 82916-1-PBS

Clone No.3K20

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

COX4I1, 3K20, COX IV-1, COX4, Cytochrome c oxidase subunit 4 isoform 1, mitochondrial

---

Product Information

82916-1-PBS targets COXIV in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1640

  Product name: Recombinant human COXIV protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-169 aa of BC021236

  Sequence: MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK

• Full Name: cytochrome c oxidase subunit IV isoform 1
• Calculated Molecular Weight: 19.6 kDa
• Observed Molecular Weight: 17-18 kDa
• GenBank Accession Number: BC021236
• Gene Symbol: COX IV
• Gene ID (NCBI): 1327
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P13073
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

COX4I1, also named as COX4 and COXIV-1, belongs to the cytochrome c oxidase IV family. It is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. COX4I1 is a marker for mitochondria. It has two isoforms (isoform 1 and 2). Isoform 1(COX4I1) is ubiquitously expressed and isoform 2 is highly expressed in lung tissues.