COXIV Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of HepG2 using 82916-2-RR (same clone as 82916-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using COXIV antibody (82916-2-RR, Clone: 2E13 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 82916-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 82916-2-RR (same clone as 82916-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using COXIV antibody (82916-2-RR, Clone: 2E13 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 82916-2-PBS in a different storage buffer formulation.

COXIV Uni-rAb^® Recombinant Antibody for IF/ICC, Indirect ELISA

Cat No. 82916-2-PBS

Clone No.2E13

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, Indirect ELISA

Synonyms

COX4I1, 2E13, COX IV-1, COX4, Cytochrome c oxidase subunit 4 isoform 1, mitochondrial

---

Product Information

82916-2-PBS targets COXIV in IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1640

  Product name: Recombinant human COXIV protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-169 aa of BC021236

  Sequence: MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK

• Full Name: cytochrome c oxidase subunit IV isoform 1
• Calculated Molecular Weight: 19.6 kDa
• GenBank Accession Number: BC021236
• Gene Symbol: COX IV
• Gene ID (NCBI): 1327
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P13073
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

COX4I1, also named as COX4 and COXIV-1, belongs to the cytochrome c oxidase IV family. It is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. COX4I1 is a marker for mitochondria. It has two isoforms (isoform 1 and 2). Isoform 1(COX4I1) is ubiquitously expressed and isoform 2 is highly expressed in lung tissues.