Product Information
87695-1-PBS targets CPA4 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag25327 Product name: Recombinant human CPA4 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 316-384 aa of BC052289 Sequence: YPYGYSVKKAPDAEELDKVARLAAKALASVSGTEYQVGPTCTTVYPASGSSIDWAYDNGIKFAFTFELR Predict reactive species |
| Full Name | carboxypeptidase A4 |
| Calculated Molecular Weight | 421 aa, 47 kDa |
| Observed Molecular Weight | 44 kDa |
| GenBank Accession Number | BC052289 |
| Gene Symbol | CPA4 |
| Gene ID (NCBI) | 51200 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9UI42 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Carboxypeptidase A4 (CPA4), a member of the metallocarboxypeptidase family, is a zinc-containing exopeptidase that catalyzes the release of carboxy-terminal amino acids. CPA4 was previously shown to play a crucial role in cell growth and differentiation by modulating or inactivating peptide hormone activity (PMID: 27904708). CPA4 expression is increased in multiple cancer tissues, including tissues from patients with pancreatic cancer, gastric cancer, esophageal squamous cell carcinoma, and lung cancer, and may serve as a potential diagnostic and prognostic marker (PMID: 31397502, 32922037).

