CPNE3 Polyclonal antibody

• 

  WB analysis using 11186-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11186-1-AP (CPNE3 antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 11186-1-AP

  WB result of CPNE3 antibody (11186-1-AP; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CPNE3 transfected A431 cells.

• 

  IP experiment of HepG2 using 11186-1-AP

  IP result of anti-CPNE3 (IP:11186-1-AP, 4ug; Detection:11186-1-AP 1:10000) with HepG2 cells lysate 1320 ug.

• 

  IHC staining of mouse liver using 11186-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 11186-1-AP (CPNE3 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 11186-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 11186-1-AP (CPNE3 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 11186-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CPNE3 antibody (11186-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

• Featured Product
• KD/KO Validated

CPNE3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11186-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Copine 3, Copine III, Copine-3, copineIII, CPN3

---

Tested Applications

• Positive WB detected in: A549 cells, A431 cells, HeLa cells, HepG2 cells, HuH-7 cells, Y79 cells
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:400-1:1600
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IHC: See 3 publications below

Product Information

11186-1-AP targets CPNE3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1634

  Product name: Recombinant human CPNE3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 238-537 aa of BC036242

  Sequence: EASRSSPVEFECINEKKRQKKKSYKNSGVISVKQCEITVECTFLDYIMGGCQLNFTVGVDFTGSNGDPRSPDSLHYISPNGVNEYLTALWSVGLVIQDYDADKMFPAFGFGAQIPPQWQVSHEFPMNFNPSNPYCNGIQGIVEAYRSCLPQIKLYGQTNFSPIINHVARFAAAATQQQTASRYFVLLIITDGVITDLDETRQAIVNASRLPMSIIIVGVGGADFSAMEFLDGDGGSLHSPLGEVAIRDIVQFVPFRQFQNAPKEALAQCVLAEIPQQVVGYFNTYKLLPPKNPATKQQKQ

• Full Name: copine III
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC036242
• Gene Symbol: CPNE3
• Gene ID (NCBI): 8895
• RRID: AB_2084214
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75131
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Copines are a family of evolutionarily conserved calcium-dependent phospholipid-binding proteins (PMID: 9430674). They contain two Ca(2+)- and phospholipid-binding domains known as C2 domains. Copines are potentially involved in regulating membrane trafficking and in protein-protein interactions.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	J Cell Physiol; Circulating exosomal CPNE3 as a diagnostic and prognostic biomarker for colorectal cancer.; Authors - Bo Sun
human	IHC	Cell Mol Life Sci; YAP1-CPNE3 positive feedback pathway promotes gastric cancer cell progression; Authors - Xuan Li
mouse	WB	Ecotoxicol Environ Saf; Polystyrene nanoplastics accelerate atherosclerosis: Unraveling the impact on smooth muscle cells through KIF15-mediated migration; Authors - Yizhou Zhong
human	WB,IHC	Front Immunol; Integration of transcriptomics and machine learning for insights into breast cancer: exploring lipid metabolism and immune interactions; Authors - Xiaohan Chen