CPOX Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CPOX Recombinant monoclonal antibody, PBS Only (87270-2-PBS)

CPOX Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87270-2-PBS

Clone No.252491B5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

COX, CPO, CPX, EC:1.3.3.3, HEM6

• 

  WB analysis using 87270-2-RR (same clone as 87270-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87270-2-RR (CPOX antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87270-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

87270-2-PBS targets CPOX in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2858

  Product name: Recombinant human CPOX protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-303 aa of BC023551

  Sequence: MALQLGRLSSGPCWLVARGGCGGPRAWSQCGGGGLRAWSQRSAAGRVCRPPGPAGTEQSRGLGHGSTSRGGPWVGTGLAAALAGLVGLATAAFGHVQRAEMLPKTSGTRATSLGRPEEEEDELAHRCSSFMAPPVTDLGELRRRPGDMKTKMELLILETQAQVCQALAQVDGGANFSVDRWERKEGGGGISCVLQDGCVFEKAGVSISVVHGNLSEEAAKQMRSRGKVLKTKDGKLPFCAMGVSSVIHPKNPHAPTIHFNYRYFEVEEADGNKQWWFGGGCDLTPTYLNQEDAVHFHRTLKEA

• Full Name: coproporphyrinogen oxidase
• Calculated Molecular Weight: 454 aa, 50 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC023551
• Gene Symbol: CPOX
• Gene ID (NCBI): 1371
• RRID: AB_3745438
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P36551
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CPOX(Coproporphyrinogen-III oxidase, mitochondrial) is also named as CPO and CPX. Human CPO is a 76 kDa protein that is active as a homodimer in the mitochondrial intermembrane pace(PMID:16159891).Mutations in human CPO gene predict the clinical outcome of the disease, with either hepatic hereditary coproporphyria or hematological manifestations of erythropoietic harderoporphyria.CPOX has a transit peptide of 110 aa and the chain contains 344 aa.