Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CPSF3 Polyclonal antibody

CPSF3 Polyclonal Antibody for WB, IHC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IP, ELISA

mRNA 3'-end-processing endonuclease CPSF-73, EC:3.1.27.-, CPSF73, CPSF 73 kDa subunit, CPSF 73

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for CPSF3 in ?

Tested Applications

Positive WB detected inC2C12 cells, HEK-293 cells, HepG2 cells, human brain tissue, HeLa cells, Jurkat cells, NIH/3T3 cells, RAW 264.7 cells
Positive IP detected inHEK-293 cells
Positive IHC detected inmouse kidney tissue, human placenta tissue, human thyroid cancer tissue, mouse cerebellum tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11609-1-AP targets CPSF3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2173

Product name: Recombinant human CPSF3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 337-684 aa of BC020211

Sequence: SRELFESWCTDKRNGVIIAGYCVEGTLAKHIMSEPEEITTMSGQKLPLKMSVDYISFSAHTDYQQTSEFIRALKPPHVILVHGEQNEMARLKAALIREYEDNDEVHIEVHNPRNTEAVTLNFRGEKLAKVMGFLADKKPEQGQRVSGILVKRNFNYHILSPCDLSNYTDLAMSTVKQTQAIPYTGPFNLLCYQLQKLTGDVEELEIQEKPALKVFKNITVIQEPGMVVLEWLANPSNDMYADTVTTVILEVQSNPKIRKGAVQKVSKKLEMHVYSKRLEIMLQDIFGEDCVSVKDDSILSVTVDGKTANLNLETRTVECEEGSEDDESLREMVELAAQRLYEALTPVH

Predict reactive species
Full Name cleavage and polyadenylation specific factor 3, 73kDa
Calculated Molecular Weight 684 aa, 77 kDa
Observed Molecular Weight 77 kDa
GenBank Accession NumberBC020211
Gene Symbol CPSF3
Gene ID (NCBI) 51692
RRIDAB_2292188
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UKF6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CPSF3 (cleavage and polyadenylation specificity factor 3) is involved in human disease and is the putative target of benzoxaboroles in trypanosomatid parasites and Cryptosporidium infection. CPSF3 has also been associated with cancer malignancy in that CPSF3 induces cell cycle arrest in hepatocellular carcinoma and promotes lung adenocarcinoma cell proliferation and metastasis (PMID: 38718887). CPSF3 has been implicated in various cancers, including lung cancer, colorectal, prostate, and triple-negative breast cancers (PMID: 37627085).

Protocols

Product Specific Protocols
IHC protocol for CPSF3 antibody 11609-1-APDownload protocol
IP protocol for CPSF3 antibody 11609-1-APDownload protocol
WB protocol for CPSF3 antibody 11609-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The CPSF3 Polyclonal antibody (Cat# 11609-1-AP) has 7 total citations published in journals including Cell Discov, Mol Cell, J Exp Clin Cancer Res, Cell Chem Biol, Cell Rep, Cell Mol Life Sci, and Cancers (Basel). Research fields span glioblastoma stem cell maintenance, transcriptional termination, TGF-β signaling in colorectal cancer, anticancer benzoxaborole mechanisms, translation machinery remodeling, oocyte maturation, and pre-mRNA splicing in hepatocellular carcinoma.

SpeciesApplicationTitle
humanWB

Cell Discov

RBBP6 maintains glioblastoma stem cells through CPSF3-dependent alternative polyadenylation

Authors - Peng Lin
  • KD Validated
humanWB

Mol Cell

Mediator regulates transcriptional termination through crosstalk with pre-mRNA 3' end processing factors

Authors - Chengjiang Lu
humanWB

J Exp Clin Cancer Res

LncRNA CASC9 interacts with CPSF3 to regulate TGF-β signaling in colorectal cancer.

Authors - Kaili Luo
  • KD Validated
humanWB

Cell Chem Biol

Anticancer benzoxaboroles block pre-mRNA processing by directly inhibiting CPSF3

Authors - Ye Tao
humanWB

Cell Rep

Proteomics reveal cap-dependent translation inhibitors remodel the translation machinery and translatome.

Authors - J J David Ho
pigWB

Cell Mol Life Sci

Single-cell multi-omics profiling reveals key regulatory mechanisms that poise germinal vesicle oocytes for maturation in pigs

Authors - Xiaolong Yuan

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer (Fabienne B) rated this product 5 out of 5 stars on June 12, 2024. She used it for Western Blot at a 1:1000 dilution on HeLa cell line (lot 00048680) and commented that it "works perfectly." Overall, the limited feedback is highly positive, with the sole user reporting excellent performance in WB applications.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Fabienne (Verified Customer) (06-12-2024)

Works perfectly

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HeLa cell line
CPSF3 Antibody Western Blot validation (1:1000 dilution) in HeLa cell line (Cat no:11609-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...