CPSF6 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CPSF6 Recombinant monoclonal antibody, PBS Only (88362-1-PBS)

CPSF6 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 88362-1-PBS

Clone No.260932G12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

CFIM, CFIm68, Cleavage and polyadenylation specificity factor 68 kDa subunit, Cleavage and polyadenylation specificity factor subunit 6, Cleavage factor Im complex 68 kDa subunit

• 

  WB analysis using 88362-1-RR (same clone as 88362-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 88362-1-RR (CPSF6 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88362-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 88362-1-RR (same clone as 88362-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CPSF6 antibody (88362-1-RR, Clone: 260932G12 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 88362-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

88362-1-PBS targets CPSF6 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7852

  Product name: Recombinant human CPSF6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC000714

  Sequence: MADGVDHIDIYADVGEEFNQEAEYGGHDQIDLYDDVISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTPCNKQFLSQFEMQSRKTTQSGQMSGEGKAGPPGGSSRAAFPQGGRGRGRFPGAVPGGDRFPGPAGPGGPPPPFPGNLIKHLVKGTRPLFLETRIPWHMGHSIEEIPIFGLKAGQTPPRPPLGPPGPPGPPGPPPPGQVLPPPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQ

• Full Name: cleavage and polyadenylation specific factor 6, 68kDa
• Calculated Molecular Weight: 59 kDa
• Observed Molecular Weight: 55-68 kDa
• GenBank Accession Number: BC000714
• Gene Symbol: CPSF6
• Gene ID (NCBI): 11052
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q16630
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The binding of Cleavage factor Im (CFIM), also known as CPSF6, to the pre-mRNA is one of the earliest steps in the assembly of the cleavage and polyadenylation machinery and facilitates the recruitment of other processing factors. CFIM is required for the first step in pre-mRNA 3′-end processing and can be reconstituted in vitro from its heterologously expressed 25- and 68-kDa subunits. It involved in RNA binding, protein-protein interactions, and subcellular localization [PMID:15169763]. In addition, it is a pre-mRNA processing protein that dynamically shuttles between the nucleus and the cytoplasm and contains a C-terminal nuclear-targeting arginine/serine-rich (RS-) domain of the type bound by TNPO3[PMID:15169763,19864460].