Tested Applications
| Positive WB detected in | TT cells, HeLa cells, rat liver tissue, mouse liver tissue, LNCaP cells, PANC-1 cells, HaCaT cells |
| Positive IP detected in | MCF-7 cells, HepG2 cells |
| Positive IHC detected in | mouse heart tissue, mouse colon tissue, human kidney tissue, rat colon tissue, rat heart tissue, mouse skeletal muscle tissue, human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66039-3-Ig targets CPT1A in WB, IHC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse, rat, pig |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7745 Product name: Recombinant human CPT1A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 406-756 aa of BC000185 Sequence: QSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPETGIISQGPSSDT Predict reactive species |
| Full Name | carnitine palmitoyltransferase 1A (liver) |
| Calculated Molecular Weight | 88 kDa |
| Observed Molecular Weight | 86 kDa |
| GenBank Accession Number | BC000185 |
| Gene Symbol | CPT1A |
| Gene ID (NCBI) | 1374 |
| RRID | AB_3670374 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P50416 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CPT1A, also named as CPT1, CPT1-L and L-CPTI, belongs to the carnitine/choline acetyltransferase family. Carnitine palmitoyltransferase (CPT) deficiencies are common disorders of mitochondrial fatty acid oxidation. The CPT system is made up of two separate proteins located in the outer (CPT1) and inner (CPT2) mitochondrial membranes. CPT1A is an active forms of related liver-type carnitine palmitoyltransferase I. (PMID: 11001805). CPT1A deficiency presents as recurrent attacks of fasting hypoketotic hypoglycemia. (PMID: 15363638). This antibody can bind the close sequences genes.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CPT1A antibody 66039-3-Ig | Download protocol |
| IHC protocol for CPT1A antibody 66039-3-Ig | Download protocol |
| IP protocol for CPT1A antibody 66039-3-Ig | Download protocol |
| WB protocol for CPT1A antibody 66039-3-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CPT1A Monoclonal antibody (5D2B8), catalog number 66039-3-Ig, has 4 total citations. These appear in Advanced Science, Biomaterials Research, Applied Biochemistry and Biotechnology, and Molecular Biology Reports. The research fields span viral replication and lipid metabolism (PRRSV/IAV), alveolar bone regeneration via macrophage fatty acid oxidation, chronic stress–driven liver cancer progression, and cardiomyocyte metabolic dysfunction through SIRT1-mediated CPT1A stabilization.
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Ferritinophagy Rewires Carnitine-Dependent Lipid Metabolism to Inhibit PRRSV and IAV Replication. | ||
Biomater Res Tryptophan-Enriched Lactobacillus rhamnosus GG-derived Nanovesicles Promote Alveolar Bone Regeneration through Macrophage Fatty Acid Oxidation. | ||
Appl Biochem Biotechnol Integrated Spatial Metabolomics and Transcriptomics Decipher the Effect of Chronic Stress on the Progression of Liver Cancer. | ||
Mol Biol Rep Nicotinamide mononucleotide ameliorates high glucose/high fat-induced cardiomyocyte metabolic dysfunction through SIRT1-mediated CPT1A stabilization. |
